ELFP4 4 ( 44p4p44q4qpp2 2 2 ввL2 HHqHqDDPtd= T5T5Qtd/lib/ld-linux.so.2GNU GNU%)U2eoV0 &!N0ER@PBdV B AH!D u"p 6H@D@@ B0 h$ (J( /I2 ) DJP@0 @@4` @IHd0@@BH@D@$ P20XDBD&0 &B @ 10 @ b( HIAT`!P Z@ 5I`hA0R0@@ A*P8@ !! $)$H!$Lb#L0 4Q`% L,P(A @B80(B@0  (P@&08 E@{BDp Yh8nਁ!P!! @@AbA`€@@Cl $"@FB 00` PPZ``$@@p! ! l E$)(  @ @ ]B\4 `,Ё#`A* (ET K5ctpp  ,@ I @$`1҉d@Aa `2 R D1c="ag !A8@\ [H$ @ 8@hMnIE! "( 0F@P`a H0(`# GB$#4[!.*ؠ PJ!@@@BD F%@ NHA @P @@"$I(B ADM DT @0 A H@  M(  `#D@B `jC@@*@ H, $E*$ @( A! Q`  8 @&! QBV@$"p( H0@X @@@h&B !\P L,4 "` DH! `$` d# ` !P@A!Y @ #`̪И@S%PD$A` `"' @@ X#@@@`T(AABa,0X$ND  H@'LP8P@ !&(8A@ "I#@A1K!P@p@($ `@1+NWW $P$D HRQ6q@HQ-(F(c ( $`@X @ 20  #&@P$`c0DX DD$"&A0`@@@H40 @&*pJ@`3@J@   vM 4(   #%'),./036789=ABDEFKLMRTUXZ[abefghjklnprtwz|}~    $&'(*,-1249>?ADEGHJLNOQSWZ^_acegjlnoptuvwy{}~ !%)+01346789<>BCEFIJKNOPQSTUWXYZ[_`bdegijlqrstuv{}~   !"&()*,01579:<?@DHIJKNPRSWXZ[\]_abdefgikmpqstuvyz{|   !$%)*+,.12456;<>?BCDEFIKLMOQUWZ\^_`dfhijkmnpstvwxyz}    !#%&+,-/12789:=>@DEFGILORSUVXY\_`defghikoqvxyz{}~ !"#'*,023578:;<=?ABDFLNORVWXY[^`dgjmoqsuxz|H J>?B JN։]Bz?X}I:d\nFĹ@6\YZ *I)vyd5> ,YkFk @h32|uF suk|{0$ёZZb7[ӪˈpRDF8uw"G)-q߼)6ϚyѝS#ɵ8!p睎d/ Pn&QMpdx?kV[RBXjbmhÛu 8aHٝZ) rcO?@=O%a67zBlc 37PN;j';V;%v`YϻLTm.Z_$\8M#J-)0b32LXx iCǯrMo!EJa}bu?oUm..CpjO7(\H "hjlz6LzlOd[9%zh&G,\Q'e;*]23'[;7n'w6 T#8 JEm· +ߓƮ7C]#TBE5 BQ=wZZ-}K QQ`B#ӓs$Āe~tpOtok…ꋑ ExxmNosvJIPщjLjN%t u9I| ?ަ eRH0ž4}{ʞ> ] Ck 4bŞR QpAHΧ I)u92 `ԵqhPDyQ/UBE[ \q{$-dK#a~JP;7cMu$~dxB,_v֞MyيS4/.H B|$(yia1:IHiF8ȬK],JD47*Q/߁ _UG ߄t"?E';tv^ : ؓ* +4j=s8R+SwݍU"n hJ3akho3ߑ'>lL(5Q/ Yɼh^k_ұ'&%L ʵwp50Mr53Bn` ++p/n@6=Mr_b^pt]WA#&46Yp[`0TrsVȣ Nlh{:un a63N  rj,/Y\3?Ht *?xy^JWBjǏpxOȪ3V++gF1FcxYp MI{oهC R!ڸPgUa;F'쵛’qsCVWKZ`ODpG1z<kKNsŏ=a'#WJf֍/_Sw"$y+WҀr'&$$ws/6Gc' iN6ʦ؂U設'dԳ%͹5ajUfd3z;`} ?,XNQ4`R16hye WP] #%<1 JLЀ}վzDC m mXD\l0zx>5.&LSe&wy}_X1$ ,ង_Vp˥D'cj{ٛ͊$3?S]jd앺̋h<6.{} 5%ޟ6E斮P16wbr ϾZe.@o`M!жLdYIsgҥa'ހTBo !w-a2.Y]?YcGHb;+ e cpaR'&6=g ڰ7,zQ-qPCIsJ4NG",沥Q>0oGLx,$pqX*;gn55gfxl ][1q_+NY} n;& "VM*ߥ,mcL_ٳTϫc_ {V$)Nd>Hf}gsU'*2^- ".WihtY~>YLB<#4=%-IlG}[|=!Ċ{5T*5êoJ僝X@Vn[pE΃K&CVZsJ ؊tjEv* Z֚W\q)zkIhf_i{Zgmx[]VUgqNpóAV=AC!*:fVqL_wu;dq! ~(wn8(޽i\9 KӢ3)Y5ɕ儏gwʇE;\5ϱ% "p'*}쏢pj.hb>2ۉ;TYy 2v]%bAIa頇̟(=J/֬$n@j*qsQcKD@6# NDЁfFUjttC[]XW⣼,!Y8[\>۲R.[b7tVرAX(R-w@]ay`ÏCSw,ʿjl&j~űJ6!@ZrFmN<]'$ ]oj)"(D҇w*ԲȠpKlFI7F<@*3Ջ9{wM1]|,uB8T1BHW8;JPB;r_Alj:{5EQ1j댏n%5A @?74 ;E8~0yv ǮDw2:{'(lR^D$2RfKxVr.,rX;,ԁuYE"Сy W6=*sKx-t%pxBJd#y Tw$rHu$>l2*s\I{?$Mc{h00"j推r!]ѴcÂӳYj19c8z?5i iwʼnI> $3[͒СJF=0Ɠ?mMl'0^FMpBg]wlU&t.߇tcV*Y!K@R nb*|TiG6 6(FƵW 򚾜m J1tg| H0$&0}_MD*Ď 6%kͼ *Bҵ^2w5Ryv5 go7\'tw ūp7b-Xn"' 8{l$QTwܐ+{SOq83-c`ך>@y 9q&_ I٬#ki܊5:CbIˬϐ Mʝ\W_SZ)g^/$J۔e")3k |>8^SGZU"B`@f:u`5 FCgQ3@z?P_(i \4Y9N'!7kP#7)d"4Zm"w>/"2X )n=\v,6ŪA%\]*ӹyNjehC QƴrKx֍)i[(APn--Ũ:e2p ߧ *"輄&i6w4c&m *:i)|t:qӣ;,G$tC.QzXKNӂޔsQ:ByPK"s(Ҩ-i OG:_E4^ 7ڱ qp͡'sz98# :YF߼Mrb$<@g".M~G1,! DČˎ®.e.y=}3N7׊E]"yj'DNϷWueBSYyʁiY_v=o/b&RE:{De _r:Nȟ-cK^浑㦜ĆlUayF&uƱ$x`i(Kdz4 bȻD3T Tn>?oQ)XMNKOPA٦}9/4 Ce{;l#"|mԯߘ[|@6Q+A+*GfY^ E^@2ir!9/Y5wʓoǾkqa 4}e\;,MS|12˼ b|IeՌ/- =7- vn#|,5'wZ/ͬZ[{ta`2BTYL/J8}jVnίۇXiPrFS$N}F/χd]F獔;>._+:;k &飞L-tv)*Gz^(m@^jPrO5^q6N|{17>.H8)_1|D%I'Υ{ ;Ũh49 w9RU--Cj8EK|^+[YvGrUYgVp̈j z>o!ܙ9U xm!hIG $|87q_ ~)7qfxʊߏ_iufy9T|Li(!*^lok CU+^KQ4sܿNbAY-j-ϞÑ׀{N-i$+sŚ^ry4𱑶7e2N^q5ΰw8,zZ/)lZKnμ66ih2W-RH a֛[]j~R%5rZ'=>y?z=ut Gy۬*IvB8!w'c.sf?jߗ?'|=:q~v8a 4 ~gܸ#atoȘw0SqnFثA`(^!"Oa1 m m`Y  m((8oH=CTr 0f"B8DO}vNKkzHY:@ ]aU2.yv hVoNcg]L Ws5SIfk1/'Vc|>gbpE5b[w&%nE1@x-Hd'C2Cv+ j=*@/ +0wQ)0P! PP44:9zMp 9 F9 #R@P +0nJ%/ E)-- Z63 c s ?H]^[t Hp' ^z Y@{ loL@lM?o, yPPC w[H8,+$P G^ @n ):`[ : boo GCb@ 5P0 KdJEs kaH >LP GL0\3 E,\; d ?VOw  i\ ` .' A}'" dZ8U%HeJ].@ IxL@q )P9N -]l0$\/M47`hz K ^?B3KK7 :!(l\NA*5J A) 1e"!CPQ`/ a` HsxV ~e%5 >UN * W\ uQ;Ymp 9F`6 4%1 d @GGC[lC7QA{, }Lo 6 R+$pg A< WZ``M: ?#l<,! q6 - : U>`  .T\)*@iS-P{ d6/_l0QD@>A 'n .T4\L 6$  ]?0pn 8pq K { I  p  -\80 _MgT( VKp v7 # % +) ^^$/CHP]  JQ o "JPY"gblc@OP G)a4 <oM)Y`  p/ ^4  VEP `#% ,XP9 h|C ` X. h8,+,&R_qQ ,, @"vB/jr0PJ @K t iP `  '0q Ska YW X|]\ !*0]s }u)`5)o\/& EulId %; a`& 67}R0  1#;"` \F*(+4 k"j@# )O4"O$Th+P< dF`HR- t`%* N QbH,d }+_Լ ]"+PK2 PF3M Dp}b"t g$0 QO^ap  u 9^+pMGF j#uR  E fQi ( DudJe, 3;0i Y@ 7J>0(J*6@h 2b#r7"^pbЎ  k2 ow r`$kL 7tpL%i9 3V:(Wp7d o@M v ePU mA3 "At 9e [BkP P@p`(8\8WF (  qD- 3m (` %SpK *!F~ 4@b22 0y U7@@Cpp xOp!(@DV,@>/, VP/V?k\ s !<5DP =+a0 #@R ^ 8P ` tГ )/V3D *\5MF \H`$J Zc P @ #l C> Ng|  +N#Ўq (Dx rtU@Jn vļ(` iB K"l$P% D<4YW04%l4G0[\A` 0E|H+   @ ( nP? Q .*0#~8<8 W0  &20a6D]?J@YE<< ^UMR6Z1p K>Xpa B+u-@ Q =xq@AC[]1d +Y8 ` 3! 9 .TJ_Qг #p V0k\  ~D 4Nv5T\= }7` EhP I`($ ba` ww[tbbpg0@q A$h@ BlШ L/J>PShNhIQ*0G"@ TJ  O Uc@ jL= #szZX l 7XJP/$ e*  FZ ` 3'00WrБ H !/80LN4Y?A; C n@W_ %6LJ {# }AU FB?0 "c #u/Vi6PuQG=+pW 7: dDp) H` ` ?$ '?4e YsO> `><. \g3 p 6L"[7BX KYJ [u0 >9?^ P- D j5OK_`  e`BDV nKp( Z8 Mp*d0-4rKLTp8M!L 64pd /dC$VD%P #@sp>%}J`_>JLs`?% 3L Ur  /hH+. s$,D1uX6?i@& 'r]  u i6 JTu nCEG9_E<0 o9s92 /C  N7 R a";&?Kn M T/_d` (R*!~@ +4#2 8,QH2 Jyo`+Њ jn`/ Ph & 8OT i`Jm$ Ag|[iPk sE_`Tt, p@S@ -p |<0& i[ E:mп 0 @ >`c\0  XSx*(\] H. -YVxJ4F8 0 g./  7`y3? 0Y l@4 1?p )N0 _BFS+ ^s/s1%&3@ W? <| Z b(UX/F3JYPIi[  10I`@q$,Ql3}U` :f/(~ ?04<" 3>`3U 8 Upw ,P #7, 3e?`iR38S~|. OpIQq{ SV\qH&<9tH#L>' kgJh  d=7 X|m +F, n G ~ Wf:l 5.PM _&voS VJ ha p( / t6],t:=P pe1I>~ I" 5V ,!\31`B( $\}-P5 K=[IRX)#p vD. & e 6R,6 s ?PLT = . 4 DP07y9sK]]Jjs)5q +4bp dj 8]-;UPKl mP& }d J}:  >D>ZP  lf m&9i!@ ) b] 4op3\5?W]A`z]`[y.J2 -Cj mAL[NPGtH0r2PfP{G zIЪ h JLpu D #5A$+[O3?3-A.B6C& D nHPs_=Q lX. Le ]jRCgt[lp /) )0 (p \( &yi@~2,J ?qX` a]YRmP' *sm`CK( R Q1JfVKxQXl5t]EP :.K@U  @i 2 Hd]S ne_P -s 'u eM5 \<0JiE̼R|JZ3 L$&0 k;|3c.4 >8O n\HoȼZ 9)3D2?k0 17p?@kdS3,ЗIAxH$CHp '|D0^ NONS }b0[0% F3f@" A?@ L FgfP&0T B  j0P{B8JU|k VP$0 ^/4 q%80  *l{a WE RO0LZ Fch>\__P5B ?r: 0 '" <HJbP+ qiP# 8c 7 2 .=e R_`<-P 8TCY(hp MNG29,e>t-m `]p|!dHH^B $[4 Ie;?N`  GI N]'5yf-  65D|HdI7 5&P^ j%V m`| M0p ?8Y CH\J\}.S' 3yk  4 wC; \tNT]Z" "`  V;y= P o }=3Lc@6q&T]9 c\/3L0_PWi0f [ 7 K w]cC~r<=@ P\ ]|\#kH!\IP0| PX nu7/,'F=u!fPT Ehs39$p ojPPv  Vh-j' mD@P )< .v\b`#?1, 3~Y>$E U)]J4 6: )G_ A@=D 'V q+?(Bj_( P 24 @wF+B2lPL/a '" -P 1mc%iSB%2+m0Yb$-%1?3G r58&) 6LtP4X4U4<0V rthJ/! b+  _`3 f0+W R0 97! 3 -l]kJf eЧ "A@ X4f od3 0 +AP ?aQ  ! 3+ 3IP +G 0o R@: Flx y$+ i(Yx6P@D4wI1 f/ QS: +2)5V,m -` -G / >8 P `  2x3fCfkbTY M,Db m]0x /' #Yg[xakDBm0qpPh?$o: ':K[[)Є TTP hp f-p+"3 K HwdA+p3s`R Lp#g QEA2#]*4\NGcJu K,+$  [A .m F;c `H;` 04Vp^0 Q3h@ v!# JH/q r X yuܼF@8?'N % {?^ KVZ ]JPW _1Mh! (Jh# .GKt3I$A t_MN N`5 *`mR0zeGB/CX'%8@ R GHW K_tn= -cGP <v) Cs0 Ks` !VDJdi;0yn( Wн?0! v]P +e %m KJR )@W<0 IM \bc@' ),#L+#[ B-Ln8 iIM GP@ j*r[ `$#H:% in& }w[q".>p _P rMPQ l)$P# C E  #g/in@ ,vt0 IJ a% qkmJs09 @) 6\QO\H%?w< 5X@*dA  +&?c/- D0M>9L@ }LU 2 bp>/sT3PB_gP~S#\uAp~ f@$d\1 -S s"_D\+\Z]@ `\\1uFV.k  Qo40) bD-d V` MW|?9^PE` 'W " +eK Ђ #- cE ) "aB[f _k@ 3@ WPB@YH-B`04 "% #UP ~V^ 9P ;8R =@! .XQ.0 9p i3AK6 3"S HE@ lc[/h'`< #GP [G2 >yxq"`.T n5 E , S RT;(XO ap RؼSL '*4' LJM@  O ' M6`9 G s\H ]jw_B0 Pt4 G.]o3y`Ro3  lH& W/ArO/%  %6>C` GV[ FJfU(XP \` <2B40)V>8De `$]L`\ F,\Կ Jl 0o!%Pm# {7!id 4ttl`6 Kct 1]_+|f?n^)0U3H0 7)Px?E(o@P5&[ pa1` RXchvJ{>P 2 I ![  [epJ^` m;%AR1o0Xl KHlJpMs]>^\cp7 U6  :6#) +ws@  k: @A`x /spQ 0 u&#3E2P 3 n&p!9 "`A'p .oQc&>$ 0v ` #9*{ 'BDi WfY3=, i @6 N_&B @2 [5w3\]F jx ]3) y`x  s[ Bmg Z(=a  >@ $J IYЩ lp& aqH\^JPtj(`qn) @/% J:p V] KuU \p R)j@BKX a ! 1O( ]/ /! AIDFJSp  ) R 4RI Tr@M8 jJf-&ft\BT8cc /p +gIhݕgIݕgIl)vݕgI)ȝ읃(0$ WtnVxnVnVnVnVnVnVnVnVe (oV,oV0oV@oVtoVoVoVoVoVoV??F??ЦF??F??F??F??Flibtinfo.so.5__gmon_start___Jv_RegisterClassesUPtgetnumBCtgetstrtgetentPCtputstgetflagtgotolibdl.so.2dlopendlsymdlclosedlerrorlibc.so.6_IO_stdin_usedsetuidsocketfflushstrcpy__printf_chksetgrentpathconf_IO_putcsetlocalembrtowctowlowergai_strerrorstrsignalstrncmpgetpwentstrrchrsetserventregexecdcgettextwcrtombgetpwuidclosedirstrncpyforksigprocmaskregfreegetgrent__stack_chk_failunlinkputcharselectstrtoldtowuppermemchrstrpbrkgetpidstrftimesbrkiswalnumiswlower__ctype_get_mb_cur_maxstrtolendpwentisattypread64fgetsgetpwnamgetppidwcschriswctype__mbrlensigemptysetgetaddrinfomemsetstrstr__errno_locationtcsetattrconfstrchdirendgrentmbtowcttynametcflowdup2clearerrunsetenvwctob__fxstat64__fprintf_chksigaddsetiswupperputenv__sigsetjmpstdoutfputcgetrusage__strtoll_internalfputsstrnlenmemcpyfclosetcsetpgrpwcscmp__memmove_chk__vsnprintf_chkstrtoulsiglongjmpkillpgstrcatumaskstrcasecmpsetpgidgetpeernamembsinit__strncpy_chkgetgidtzset__lxstat64opendir__xstat64__ctype_b_locregcompwcwidthstderrsigdelsetioctlalarmsetrlimit64group_member__snprintf_chkgetgroupsgetuidreadlinkgetegidstrncasecmpsendmsgfilenogethostnamegetcwdfwritegettimeofdaysigactiongeteuid__memcpy_chksrandomwaitpidlocaltimelseek64__vfprintf_chkmblenfdopenreaddir64qsorttcgetattrsleep__ctype_toupper_loc__strcpy_chk__ctype_tolower_locfreeaddrinfosetvbufwcscollfcntlgetrlimit64__sprintf_chkwcsdupgetdtablesizememmovefopen64endserventwcsrtombsbindtextdomainsetgid__strcat_chk__strtoull_internal__asprintf_chktcgetpgrp__libc_start_mainsetpwentferrorwcslenstrcollwcsncmpsysconfgetservent__environ_edata__bss_startinitialize_job_controlsys_errormaybe_make_export_envemacs_meta_keymapeval_docdispose_wordsh_double_quote_rl_clear_screenrl_completion_query_items_rl_term_IClast_command_exit_signal_rl_insert_typeintimes_builtinrl_copy_textlast_command_subst_pidifs_firstc_rl_find_completion_wordget_history_eventrl_vi_yank_toprompt_string_pointer_rl_disable_tty_signalsget_job_by_pidlist_minus_o_optsmake_select_commandemacs_standard_keymapdisable_priv_moderl_tty_statusrl_tilde_expandbuiltin_doc_rl_nsearch_callbackcurrent_host_namesh_canonpathput_command_name_into_envdiscard_unwind_framerunning_under_emacsdequote_stringposix_readline_initializestring_list_dollar_starexecute_command_internalprintf_builtin_rl_init_line_staterl_copy_forward_wordsh_contains_shell_metassh_exitnamed_function_stringit_groupsreader_loopsv_ignoreeoftt_setonecharreadline_internal_charno_argsupdate_export_env_inplace_rl_erase_entire_lineprog_completion_enabledsccs_versionreadline_top_levelextract_array_assignment_listrl_backward_wordprint_commandlocal_builtinprogcomp_sizerl_transpose_charsthe_current_working_directoryansiexpand_rl_keyseq_cxt_allocrl_kill_wordindirection_level_stringarray_disposerl_tty_unset_default_bindingsset_signal_handlermake_subshell_commandarith_for_doclast_command_exit_valuesv_histignorerl_completion_modekill_current_pipelinehistory_basedstackpolite_directory_formatxdupmbstowcsmake_builtin_argvrl_vi_start_insertingbash_add_historyenable_doclogout_doc_rl_input_queued_rl_parsing_conditionalized_outstrlist_to_word_listrl_overwrite_moderemember_argsdispose_cond_node_rl_strip_promptrl_filename_quote_characterswhile_docnew_var_contextset_bash_input_fdsubstringbash_tilde_find_wordrl_backward_char_searchlast_shell_builtinhistory_length__libc_csu_finirl_initializelist_opttypenumber_of_argsprog_completesarray_dispose_elementrl_forward_charmake_wordset_current_prompt_levelrl_vi_append_modelist_rest_of_argssource_builtinrl_completion_typebuiltin_error_rl_get_screen_sizebind_variable_valuepushd_builtinxpg_echoremove_history_rl_enable_meta_key_rl_convert_meta_chars_to_asciirl_vi_redott_setnocanonget_variable_value_rl_term_imrl_gnu_readline_pfree_buffered_streamrl_funmap_namesshopt_setoptsh_readonly_rl_set_mark_at_posit_signals_rl_savestringshell_execvewlcachesv_histcharscontinue_docpat_substbrace_arg_separatorstart_pipelinerl_dispatchingrl_reset_terminalhash_walkjust_one_commandrl_add_funmap_entryrl_directory_rewrite_hookfind_function_rl_complete_mark_directoriescommand_string_indexget_dirstack_from_stringwrite_historyrl_display_promptread_octalrl_vi_tilde_expandrl_set_keyboard_input_timeoutrl_unbind_command_in_map_rl_out_streamrl_instreamxstrchrrl_display_fixedall_visible_variablesrl_forwardreplace_history_entryrl_show_charrl_resize_terminalrl_bind_key_if_unbound_in_maprl_reset_screen_sizesh_getoptrl_messagereplace_history_dataumask_docrl_macro_dumperarray_rshift_rl_vi_initialize_linefind_variable_internalifs_firstc_lensignal_namefind_variableinternal_strmatchrl_abortno_optionsinitialize_trapsparse_and_executesh_notfoundend_job_controlunbind_args_rl_init_terminal_ioumask_builtinrl_on_new_line_with_prompthash_stringsh_notbuiltinquote_globbing_charsdist_versionexecutingsubshell_argvttsetattrsource_searches_cwdrl_noninc_reverse_searchget_current_user_inforl_execute_next_rl_copy_undo_entryrl_macro_bind_rl_control_keypadxfreerl_get_keymap_namecommand_connect_rl_kscxtit_shoptsselect_doc_rl_free_saved_history_line_rl_term_forward_charpopd_builtinrl_byte_orientedshow_name_attributeshistory_write_timestampsbreak_docbash_readline_initialized_rl_horizontal_scroll_modewith_input_from_stdinmake_word_from_tokenno_invisible_varscheck_hashed_filenamesrl_variable_valuehistory_expansion_charmaybe_execute_filehist_last_line_addedsave_parser_stateuitoschange_flagtrue_doccurrent_readline_line_indexdescribe_pidtop_level_maskrl_on_new_line_rl_adjust_pointit_keywordsmaybe_append_historyall_exported_variablesset_shelloptsthe_printed_commandsignal_namesdelete_job_rl_term_eimaybe_set_sigchld_trapunquoted_glob_pattern_ppush_stream_fp_hwrl_bind_key_in_maplast_asynchronous_pidrl_basic_word_break_characterssuspend_docfind_shell_builtinarray_patsubrl_pending_input_rl_page_completionsbuiltin_address_internalinitialize_terminating_signals_rl_possible_control_prefixes_rl_eof_char_rl_suppress_redisplaygive_terminal_torl_unbind_function_in_maprl_copy_keymaprl_reverse_search_historyalias_expand_allrl_filename_dequoting_functionparse_and_execute_levelexecute_commandrl_doneshould_ignore_glob_matchesstrlist_prefix_suffixtime_to_check_mailset_buffered_streamrl_restore_staterl_inhibit_completionhistory_expansion_inhibitedpipeline_pgrprl_key_sequence_length_rl_set_insert_moderemember_on_historyrl_ignore_completion_duplicatesstrsubpwd_docenable_hostname_completiontt_setcbreakpop_contextlet_builtindispose_variablettattr_rl_output_some_charscommand_word_completion_functionsh_regmatchall_array_variablesbash_brace_completionread_historymake_cond_noderl_completion_append_charactereof_encountered_limitposix_initialize_rl_keyseq_chain_disposerl_yankmax_input_historyinitialize_bash_inputpop_var_contextrl_universal_argumentcheck_identifiersh_single_quotelist_running_jobszsyncfdhistory_quotes_inhibit_expansionstrlist_from_word_listtermsig_sighandlerbash_default_completionbinary_testps2_prompthistory_getuinttostrcurrent_usercurrent_command_line_count_rl_arg_overflowrl_yank_popreturn_catch_flag_rl_enable_keypadinitialize_aliasesrl_possible_completionsrl_binding_keymapexit_builtinrl_restore_promptsuspend_builtinrl_ignore_some_completions_functionrl_generic_bindrl_filename_quoting_desiredtt_seteightbitrl_set_keymaprl_vi_change_charbuild_versionreadline_internal_setuprl_getc_functionget_array_valueword_splitfile_statusset_sigchld_handlerrl_visible_prompt_lengthhistory_lines_this_session_rl_term_clreolit_arrayvarstilde_initializeexec_docclose_buffered_fdall_variables_matching_prefixrl_rubout_or_delete_rl_last_v_posrl_translate_keyseqcurrent_readline_prompt_rl_isearch_dispatchit_serviceserror_trace_modefind_reserved_wordsh_set_lines_and_columnsxtrace_print_for_command_headduplicate_buffered_streamget_shopt_options_rl_push_executing_macrohistory_builtinzreadcrl_vi_searchvariable_context_rl_enable_metauser_command_matchesstrvec_dispose_rl_dispatch_subseqhistory_lines_in_filerl_executing_macrorl_backward_char_rl_input_availablehashing_enabledulimit_doccurrent_command_subst_pidrl_deprep_term_functionarray_removerl_dump_variablescompgen_builtin_rl_char_valuetrap_to_sighandlerrl_character_lentype_builtinset_pipestatus_arraystrlist_disposeit_jobsrl_rubouterr_badarraysubrl_add_defunset_locale_varadd_history_timesh_optoptreturn_builtinsv_strict_posixpop_scope_rl_doing_an_undorl_catch_sigwinchhistory_inhibit_expansion_functionclear_historycdspellingreturn_catchstrvec_copysave_token_stategetmaxchildmake_word_listrl_editing_moderl_forward_search_historymake_simple_commandcommand_errstrhistory_is_stifledget_directory_stack_rl_vi_reset_lastsource_docrl_beg_of_linerl_complete_rl_backspacepopd_docrl_redisplaylast_history_lineunset_builtinrl_clear_pending_inputbash_servicename_completion_function_rl_insert_charcompgen_docgetmaxgroupsttnocanonrl_get_keymap_by_namestream_on_stackexpand_arith_stringrl_kill_regionsh_mktmpfdunbound_vars_is_errordisown_docprogcomp_removebind_var_to_intexport_builtinbind_builtinnoclobberset_tty_stateexpand_prompt_stringremove_aliashist_last_line_pushedparse_shelloptsinitialize_shell_builtins_rl_clear_to_eolcommand_execution_stringmaybe_add_historyindirection_levelrl_copy_backward_wordother_token_alistsh_statcmd_initset_signal_ignoredcurrent_command_numberabsolute_pathnamestring_list_internalrl_arg_signstrvec_sortprint_func_listreset_signal_handlers_rl_terminal_can_insert_rl_term_ipwant_pending_commandhistory_searchsh_invalidoptrl_vi_insert_modewait_signal_receivedrestore_default_signalset_job_controlunbind_array_elementarray_createset_error_traprl_bind_keyseq_in_mapshift_builtinno_symbolic_linksbuiltin_usagereadonly_builtinrl_clear_signalstilde_expansion_preexpansion_hookkill_docfg_percent_docinterrupt_immediatelysh_mktmpnamedispose_fd_bitmaprl_insert_commentrl_newlinedo_word_assignment_rl_internal_char_cleanupget_minus_o_optsset_dollar_vars_unchanged_rl_term_pcdefault_tty_job_signalsrl_readline_statearray_inserthistory_subst_charrl_completer_word_break_charactersunset_docsv_histtimefmtunwind_protect_memwdcachecleanup_the_pipelinesh_invalidsigwait_builtinexec_builtindirs_builtinparse_string_to_word_list_rl_enable_paren_matchingcopy_function_def_contentspop_dollar_vars_rl_dispatchsourcelevelget_current_prompt_levelfind_string_in_alistdescribe_commandtrap_docmake_word_flags_rl_rubout_charphash_searchrl_vi_subst_rl_complete_mark_symlink_dirsbash_input_fd_changed_rl_set_the_linetest_docalloc_word_descrl_insert_moderl_directory_completion_hooksv_opterrstupidly_hack_special_variables_rl_search_getcharsetifsstream_listset_itemlist_dirtyfatal_errorsubshell_argcpre_process_lineprint_arith_commandrl_completion_matchesrl_tab_insertstring_rest_of_argsprint_var_functionloop_levelextract_arithmetic_substlocaletransarray_to_stringrl_modifyinghistory_tokenize_rl_redisplay_after_sigwinchfind_flag_rl_make_prompt_for_searchfg_builtindispose_exec_redirectsreturn_doc_rl_get_char_lenlocal_exported_variablesunset_bash_input_rl_abort_internalrl_copy_region_to_kill_rl_move_vert_rl_meta_flagmake_case_commandrl_undo_listprintf_docconditional_doc_rl_reset_argumentrl_make_bare_keymapinitialize_shell_optionsfail_glob_expansionget_working_directoryrl_get_next_historyfind_tempenv_variablemake_function_def_rl_term_dccommand_builtinsh_unset_nodelay_modestatic_shell_builtinsset_var_read_onlyrl_completion_mark_symlink_dirscolon_doccd_docrl_invoking_keyseqsfunction_dochistory_get_timettcbreaktime_doczwrite_getenvstdin_redirget_exitstatrl_read_init_filevi_insertion_keymapbuiltin_builtinrl_filename_completion_desiredbuiltin_addresshistory_expansion_rl_term_gotorestore_original_signalsmaybe_save_shell_historyunset_sigwinch_handler_rl_in_streamrl_completion_display_matches_hookreset_shell_flagsrl_end_undo_groupbegin_unwind_framedisown_builtinrl_crlfset_debug_trap_rl_copy_undo_listrun_return_trapdeclare_doc_rl_restore_tty_signalscheck_binary_filedispose_saved_dollar_varssh_invalidoptname_rl_screencharsrl_named_functionlist_all_jobsrl_bind_key_if_unboundrl_unix_word_ruboutalias_expandmake_local_variabledisallow_filename_globbingalready_making_childrenreset_internal_getoptrl_vi_prev_wordexpand_string_unsplitifs_var_rl_keymapde_backslashbash_directory_completion_matchesrl_executing_keymaprl_complete_with_tilde_expansionsame_file__data_startcurrent_command_first_line_savedbash_history_disablewhich_set_flagsrl_display_match_listrl_delete_horizontal_spacerl_unbind_key_in_map_rl_move_cursor_relativeget_group_listbash_initialize_historysh_mktmpfpglob_ignore_caseall_shell_variableslist_one_jobrl_replace_from_historysh_invalididrl_vi_putrl_backward_kill_linerl_free_undo_listzreadintrhistory_delimiting_charswithout_job_controlrl_arrow_keysmake_command_stringtype_docmap_overset_default_langdispose_used_env_varslcurrentfifos_pending_rl_callback_data_disposemake_if_commandwait_forvariable_help_docthis_command_namesource_fileignore_tty_job_signalsclean_itemlistsubshell_envpsv_histsizehistory_doc_rl_free_history_entryclose_fd_bitmapbash_getcwd_errstrpush_dollar_varserr_readonlyrl_free_line_stateset_working_directorysubshell_environmentrl_outstreamprint_simple_commandsv_comp_wordbreaksphash_insertrl_save_promptrl_dump_macrosmake_variable_valueread_from_stdininitialize_signalsuntil_docit_functionstilde_expand_wordlegal_alias_namefunmap_program_specific_entry_startexpand_words_shellexpsh_neednumargtilde_additional_prefixescommand_substituteadd_aliasget_word_from_stringget_hostname_listyycharasynchronous_notificationrl_completion_found_quoteifs_cmapcase_docassign_array_from_stringrl_pre_input_hookshopt_builtindirs_docgetifs_rl_char_search_internalstrlist_resizerl_vi_back_to_indentrl_vi_checkexecutable_filejsmalloc_trace_at_exitinitialize_flagsstrvec_from_word_liststdin_redirectsbind_keyseq_to_unix_commandsh_backslash_quoteposixly_correctset_login_shellterminate_stopped_jobsbash_badsub_errmsgarray_unshift_elementrl_vi_delete_rl_vi_textmod_commandrl_vi_bWordrl_reset_line_staterl_variable_dumperit_builtinshist_verifyget_name_for_errorprivileged_modeno_line_editinghistory_comment_charrl_already_promptedsplit_at_delims_rl_arg_callbacksh_restrictedinterrupt_statethe_current_maintainerrl_tty_set_default_bindingssh_setlinebufrl_unix_line_discardrl_vi_fWordrl_make_keymap_rl_fix_point_rl_with_macro_inputsh_backslash_quote_for_double_quotesvalid_array_referencesh_makepath_rl_find_prev_mbcharexpand_words_no_varsrl_completion_entry_functionrl_vi_insert_begfmtulonglong_argspipefail_optmailstathistory_search_delimiter_charshistory_search_posmap_over_funcsrl_vi_char_searchsh_nojobsttrestoreprint_cond_commandrltty_set_default_bindingsassign_array_var_from_word_listrl_begin_undo_grouprl_initialize_funmaprl_library_version_rl_unget_char_rl_pop_executing_macrointernal_wstrmatchget_job_by_name_rl_comment_beginkill_all_local_variablesit_setoptsexecute_variable_commandrl_get_keymap_name_from_edit_moderl_insert_textrl_attempted_completion_functionhash_builtinarray_keys_rl_want_redisplayset_default_localeit_filesmark_modified_varsread_builtinrun_debug_trapget_random_numberwordexp_only_rl_complete_show_allreset_parsersigint_sighandlernum_shell_builtinsgen_compspec_completionsset_return_traprl_get_termcapmk_msgstr_rl_init_eightbit_rl_term_backspacehistory_expand_rl_callback_dataexecuting_line_numberexpand_string_to_stringunstifle_history_rl_find_next_mbcharrl_event_hookexit_shellinit_yy_ioclear_hostname_listlist_optarg_rl_output_meta_charshash_copyarray_create_elementglob_vectorexpand_word_unsplitshell_is_restrictedrl_vi_overstrike_deleterl_digit_argumentrl_vi_overstrikerl_capitalize_wordrl_bind_keyseqsave_pipelinestrlist_createrl_vi_set_markreadline_echoing_pinternal_warningshell_compatibility_levelrl_redisplay_functionfc_execute_fileyy_input_name_rl_scxt_disposechar_is_quotedfind_index_in_alistsignal_is_specialwith_input_from_stringrl_noninc_forward_searchrl_yank_nth_arg_rl_dispatching_keymaprl_stop_outputforce_append_history_rl_dispatch_callbackprotected_mode_rl_to_lowerbash_logoutclear_unwind_protect_listrl_vi_delete_tosecondary_promptsh_optargrl_history_search_backwardis_directorymove_to_high_fdrl_num_chars_to_readrl_transpose_wordssh_un_double_quoterl_char_is_quoted_pmake_arith_for_commandbash_history_enablerl_terminal_namefind_user_commandlist_lengthglobal_error_listsh_erangezcatfdcaller_dochistory_set_history_stateunbind_variable_rl_pushed_input_availablerl_callback_read_charsignal_is_trappedenable_builtindelete_last_historyrl_revert_linerelease_statusrl_start_kbd_macro_rl_overwrite_rubout_rl_strindextrap_builtinhelp_builtindispose_var_contextshopt_listoptsh_needargansicstrdispose_function_defarray_to_argv_rl_callback_funcsv_localesubshell_top_levelshell_namexstrmatch_rl_vis_botlinstrlist_appendfc_docrl_get_keymaprestricted_shelldont_save_function_defs_rl_set_cursorstrcreplaceclose_pgrp_pipehistory_no_expand_charsrl_set_signalscompletions_to_stringlist_rl_output_character_functionrl_delete_textshow_shell_versionevalexp__libc_csu_initungetc_with_restart_rl_argcxtttnoechodeclare_builtin_rl_term_uprl_attempted_completion_overrl_deletepush_contextrl_replace_linesh_badjobrl_upcase_wordrl_completion_word_break_hookstrip_trailing_ifs_whitespacerl_markarray_variable_name_rl_term_icrl_backward_byte_rl_last_command_was_killdispose_word_descclean_simple_commandrl_re_read_init_filerl_vi_goto_markcd_builtin_rl_isearch_callbackmake_redirectionrl_forced_update_displaycheck_window_sizeprogramming_errorrl_noninc_reverse_search_againxmbsrtowcsarray_expand_index_rl_arg_getchar_rl_completion_case_foldrl_vi_change_casecommand_errorloptendarith_docshell_version_stringexpanding_redirreturn_EOFsync_buffered_streamrl_linefunclogout_builtin_rl_term_autowrap_rl_allow_pathname_alphabetic_charstrap_saved_exit_value_rl_isearch_terminatorsset_ppidstartup_statestrlist_mergeexpand_compound_array_assignmentrl_vi_fetch_historyit_disabledhistory_get_history_stateprogcomp_flushecho_command_at_execute_rl_pure_alphabeticforce_fignorewait_docrl_exchange_point_and_markshell_start_timebind_functionparser_errorbash_groupname_completion_functioncurrent_prompt_stringgetopts_resetrl_vi_domoveremember_mail_datesexpand_wordsparse_symbolic_modedecode_prompt_stringrl_set_markwait_for_background_pidsstrvec_resizeif_docextended_globassign_array_var_from_stringdisplay_signal_listfree_pushed_string_inputvi_movement_keymapdo_redirectionsstart_jobget_new_window_sizecontinuingaddtimevalmatch_ignore_caserunning_trapansic_shouldquoteextract_process_substrl_dingfalse_docset_pwd_rl_callback_data_allocrl_vi_columnneed_here_docabsolute_programhistory_reeditingrl_refresh_line_rl_is_mbchar_matchedrl_last_funcstrvec_removebreakingxtrace_print_assignmentbind_array_variableexpand_string_assignmentjump_to_top_levelrl_complete_internalstrlist_copyignore_signalfind_aliasdelete_all_aliasessh_syntabsizttgetattrunlink_fifo_liststrvec_lengetopts_docpop_streammake_group_command_rl_digit_pskipsubscriptrl_set_prompthash_sizerl_vi_first_printredirection_expandlegal_identifierfile_errorlist_optoptgrouping_braces_docplace_keywords_in_env_rl_erase_at_end_of_linearray_keys_to_word_listbind_int_variableoptflagsreset_mail_filesskip_to_delimcaller_builtincommand_oriented_historysh_validfdrl_discard_keymapsv_history_controlsigwinch_receivedsh_physpathwait_intr_bufmaybe_make_restrictedrl_unbind_key_rl_digit_valuerl_vi_ewordadd_unwind_protecthash_disposerl_invoking_keyseqs_in_maprl_line_buffer_lencolon_builtin_rl_history_preserve_pointunbind_funcsh_realpathrl_vi_replacerl_reset_after_signalget_tty_statemake_until_commandcopy_function_def_rl_iscxtrl_filename_completion_functiondo_assignmentrl_alphabeticrl_vi_insertion_moderl_catch_signalsrl_kill_textrl_visible_statscopy_history_entry_rl_scxt_allocrl_forward_wordremove_backslasheshistory_arg_extractget_locale_varrun_unwind_protectsrl_basic_quote_characterssetup_async_signalscurrent_readline_linesearch_for_commandrl_add_undo_rl_fix_last_undo_of_typeunfreeze_jobs_listsignal_in_progresstest_commandrl_special_prefixesrl_vi_bwordphash_flushdispose_redirectsrl_vi_eof_maybettonecharcheck_bash_inputsh_get_home_diremacs_ctlx_keymap_rl_vi_last_commandsetup_ignore_patternsrl_forward_bytesh_badpidfull_pathnametteightbitforced_interactiverl_completion_suppress_quotetimes_docrl_backwardarray_assign_listset_minus_o_optionall_digitsdebugging_login_shellrl_get_previous_historyrl_getcrl_variable_bindget_numeric_argeof_encounteredshift_docifs_valuemake_commandrl_deprep_terminalreset_mail_timerrl_completion_suppress_appendhup_on_exityyerrormake_bare_simple_commandfg_docrl_promptrl_filename_quoting_functionfilter_stringlistrl_kill_full_linesh_getopt_restore_statedelete_all_jobssigwinch_sighandler_rl_compare_charssv_optindrl_vi_fwordrl_point_rl_any_typeinecho_builtinread_commandsh_invalidnummake_here_documentset_langrl_readline_versionrl_function_of_keyseqcurrent_fds_to_closearray_quotequote_string_for_globbinggnu_error_formatclose_buffered_streamlocal_docinteractive_shellulimit_builtintypeset_docexpand_assignment_string_to_string_rl_mark_modified_linesset_dirstack_elementwait_for_single_pidrl_endbash_dequote_textset_or_show_attributesrl_beginning_of_historystrlist_flush_rl_saved_line_for_historydecode_signal_rl_free_match_listrl_parse_and_bindphash_removerl_menu_completeunalias_builtinbrace_expandfind_path_filebase_pathnameansic_quotemake_local_array_variableprint_timevalhistory_search_prefixnohup_all_jobsrl_expand_promptthrow_to_top_levelcompspec_copyconnect_async_listttsave_rl_last_c_poscopy_redirectall_visible_functionslist_stringcopy_commandpushd_dockill_pidnew_fd_bitmapterminating_signalrl_vi_movement_modeadjust_shell_levelsh_badoptdequote_listsh_mkdoublequotedfind_special_builtindispose_function_def_contentsrl_prep_terminalparse_and_execute_cleanupparse_command_rl_set_screen_sizerun_pending_trapsfile_iswdir_rl_current_display_linebg_builtinsh_get_env_value_rl_vi_set_lasttrap_listrl_insert_closestrlist_printrl_clear_messagefc_builtinxtrace_print_select_command_headtimeval_to_secsfalse_builtinrl_vi_next_word_rl_bell_preferencearray_shift_elementcontinue_builtinarray_shiftfind_or_make_array_variablerl_discard_argumentrun_interrupt_trapget_group_arrayprint_shift_errorgetopts_builtinbuffered_ungetchartempenv_assign_errorshow_var_attributesxtrace_print_cond_termprint_var_valuesh_wrerrorsh_syntaxtabcurrent_builtinfmtumaxit_commandsrl_blink_matching_parenrl_set_paren_blink_timeoutrl_vi_undorestore_parser_staterl_quoted_insertwhere_historyrl_startup_hook_rl_arg_init_rl_vi_done_insertingcdable_varsglobal_commandextract_colon_unitwcsmatch_rl_nscxtmaybe_call_trap_handleropen_buffered_streampatch_levelSBsv_pathit_aliases_rl_to_uppercheck_dev_ttystrip_trailingbrace_expansion_rl_update_finalit_directoriesread_docprogcomp_createglob_error_return_rl_term_crdispose_wordsrl_prefer_env_winsizedefault_buffered_inputcond_expand_wordit_hostnamesrl_cleanup_after_signalfind_token_in_alistrl_char_searchprogcomp_searchrl_set_keymap_from_edit_modesv_tzcommand_docrl_maybe_replace_linereset_shell_optionsit_exportsdollar_dollar_pidrl_inserthash_doclast_made_pidunclosed_pairset_dollar_vars_changedmakunboundterminate_immediatelyrun_unwind_framesubshell_level_rl_next_macro_keyhangup_all_jobsthis_shell_builtinconvert_var_to_arraymake_new_array_variableit_usersbuffered_getcharprogcomp_disposereadonly_docrl_noninc_forward_search_againxtrace_print_case_command_head_rl_lowercase_ptest_bracket_docpromptvarsinitialize_itemlistjobs_docnetopenminus_o_option_valuedump_po_stringsnotify_and_cleanuprl_kill_linerl_vi_matchcurrent_historyset_default_locale_vars_rl_possible_meta_prefixeshistory_listcompspec_createcomplete_builtin_rl_arg_dispatchrun_exit_trapshell_ttystrvec_to_word_listrl_insert_completionsstrlist_walkrl_backward_kill_wordextract_command_substperform_hostname_completionrl_vi_end_wordbashline_reinitializepop_argsexec_redirection_undo_listnohup_jobsignal_is_ignoredarray_quote_escapessh_optindassign_compound_array_listwith_input_from_streamrestore_token_staterl_push_macro_inputrl_readline_namerl_bind_keyseq_if_unbounddispose_commandmbstrlenxmallocsave_bash_inputtest_binop_rl_read_mbchararray_variable_partrl_undo_command_rl_screenwidthall_shell_functionsexpand_aliasesecho_docexport_docps1_promptprogcomp_insertfd_is_bash_inputhistory_word_delimitersreset_shopt_optionshistory_max_entries_rl_start_using_historysh_opterrrestart_job_controlsort_variablesmail_warningcompspec_disposetest_builtinpush_var_contextstrlist_removerl_callback_handler_installspnamearray_flushrl_emacs_editing_moderl_maybe_unsave_lineword_token_alistfree_mail_fileshistory_total_bytespush_argsxtrace_print_word_listterminate_current_pipelineunary_testlist_reversearray_to_word_listmake_while_commandprimary_promptallow_null_glob_expansioncheck_add_historyyylvalrl_explicit_argrestore_pipelinerl_read_keystop_making_childrentilde_expansion_failure_hookdump_translatable_stringslet_docmake_arith_commandbreak_builtinhistory_numberphash_createdo_assignment_no_expandrl_maybe_save_lineadd_or_supercede_exported_varunalias_docsetup_glob_ignoremake_absoluterl_list_funmap_namesvar_lookupshell_initializedrl_completer_quote_charactersEOF_Reachedtop_level_cleanupglobal_variablesword_list_remove_quoted_nullsprint_rlimtypearray_copyrl_vi_yank_argrl_end_of_historyrl_callback_handler_removerl_extend_line_bufferrl_set_retained_kills_rl_match_hidden_filesset_pipestatus_from_exitinternal_errorrl_vi_append_eolstring_list_dollar_at_rl_kill_kbd_macrocopy_wordrun_trap_cleanupdebugging_moderl_vi_eWordremove_unwind_protectzreadbash_re_edit_rl_undo_group_levelyynerrsprint_var_listeval_builtinarray_from_word_listexit_docexit_immediately_on_errorarray_sliceget_alias_valuett_setnoechorl_completion_quote_characterjobs_builtinreturn_catch_valuebg_docset_signalerr_unboundvarreport_errorread_but_dont_executesv_ifsdelete_all_contextsecho_input_at_readstring_to_rlimtypedot_found_in_searchyyparsemake_for_commandrl_unix_filename_ruboutrl_downcase_wordit_bindingsno_empty_command_completionrl_stuff_charset_var_attributebgpidsset_sigint_handlerprogrammable_completionsalloc_history_entryshell_glob_filenamerl_do_undothis_shell_functionarray_needs_makingsh_eaccesscomplete_docnoglob_dot_filenameswait_for_job_rl_term_DC_rl_bind_stty_chars_rl_qsort_string_comparestring_quote_removaldifftimevalfind_function_defhostname_list_initializedsource_uses_pathget_dollar_var_valuerl_vi_change_toarray_to_assignrun_error_trapit_enabledhash_bucketrl_erase_empty_linesv_globignoreexecutable_or_directoryzreset_rl_read_mbstring_rl_screenheightrl_do_lowercase_versionget_job_specrl_dump_functionsmake_funcname_visiblekill_builtinrl_vi_arg_digitxreallocexpand_word_leave_quotedsubst_assign_varlist_rl_overwrite_char_rl_term_clrpagrl_set_keyhistory_truncate_filerl_vi_bracktypereset_terminating_signalsjobs_m_flagexpand_stringrl_call_last_kbd_macrohistory_set_posprint_array_assignmentmake_bare_wordrl_function_dumpersv_terminaloriginal_pgrpisnetconndot_docinitialize_shell_variables_rl_clean_up_for_exitreap_dead_jobsalias_expand_word_rl_complete_show_unmodifiedxtrace_print_arith_cmd_rl_uppercase_p_rl_keyseq_cxt_disposeget_string_valuearray_walkrl_history_search_forwardthe_printed_command_sizepush_scopeexecute_shell_functionwith_input_from_buffered_streamrl_prep_term_functionmake_pattern_listthe_printed_command_except_trapredirection_errorrl_delete_or_show_completionsrl_yank_last_argit_stoppedset_if_notrl_username_completion_functionlist_stopped_jobs_rl_replace_text_rl_walphabeticno_exit_on_failed_execgather_here_documentsbash_history_reinitsv_hostfiletimeval_to_cpumerge_temporary_envsub_append_stringrl_bind_keyseq_if_unbound_in_mapinteractive_commentsrpm_requiresstrlist_sortmake_default_mailpathrl_save_state_rl_add_macro_charfunction_trace_modeit_variablesload_historyassign_array_elementtilde_additional_suffixestermsig_handlerpwd_builtinit_runningextended_quote_rl_history_saved_pointsetup_history_ignorecopy_word_listpushed_string_listmake_cond_commandtest_unopinit_job_statslocaleexpandstrvec_flushrl_vi_search_againbash_tilde_expandreadline_internal_teardownbind_docshopt_docrl_line_bufferrl_restart_outputrl_numeric_argcount_all_jobsrl_end_kbd_macrolegal_numberread_history_rangearray_subrangerl_vi_editing_modeinitialize_readlineinitialize_job_signalsrl_vi_ruboutmake_childunbind_function_defrl_end_of_linerl_bind_keyliteral_historyread_secondary_linesv_mailhistory_offsetstrvec_createshell_function_defscopy_redirectsxbcopydelete_all_variablesrl_untranslate_keyseqexpand_string_unsplit_to_stringstop_pipelinefd_to_buffered_stream_rl_print_completions_horizontallyrl_vi_completeprogcomp_walkterminal_pgrpassign_in_envfile_isdirshell_pgrpstrvec_strcmpGLIBC_2.1GLIBC_2.0GLIBC_2.4GLIBC_2.8GLIBC_2.3GLIBC_2.2GLIBC_2.3.4/lib/ld-linux.so.2   h0ii Jvii Tvii ^vii hvii rvii |vti vii Jvii Tv8M̳гԳسܳ       $(,048<@D H!L"P#T$X%\&`'d(h)l*p+t,x-|./0123456789:;<=>?Ĵ@ȴA̴BдCԴDشEܴFGHIJKLMNOPQ RSTUV W$X(Y,Z0[4\8]<^@_D`HaLbPcTdXe\f`dghhlipjtkxl|mnopqrstuvwxyz{|}iĵ~ȵ̵еԵصܵ  $(,048<@DHLPTX\`dhlptx|Ķȶ̶жԶضܶUS[ t 蠩X[5ij%ȳ%̳h%гh%Գh%سh%ܳh %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx% h%h%h%h%h% h%$h%(hp%,h`%0hP%4h@%8h0%<h %@h%Dh%Hh%Lh%Ph%Th%Xh%\h %`h(%dh0%hh8p%lh@`%phHP%thP@%xhX0%|h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%Ĵh%ȴh%̴h%дh%Դh%شh%ܴh %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx% h%h%h%h%h% h%$h%(hp%,h`%0hP%4h@%8h0%<h %@h%Dh%Hh%Lh%Ph%Th%Xh%\h %`h(%dh0%hh8p%lh@`%phHP%thP@%xhX0%|h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%ĵh%ȵh%̵h%еh%Եh%صh%ܵh %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx% h%h%h%h%h% h%$h%(hp%,h`%0hP%4h@%8h0%<h %@h%Dh%Hh%Lh%Ph%Th%Xh%\h %`h(%dh0%hh8p%lh@`%phHP%thP@%xhX0%|h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%Ķh%ȶh%̶h%жh%Զh%ضh%ܶh %h(1^PTRhe he QVhCUS=u@ܲ-زX9sBز9r[]Ív'Utt $ÐU]u0t ]u]Ð $$$7\$$L0^t;uW$7/bin@/sh4^$b$7\$$8]u]Xt&$,$]7\$$롍&D$D$e $0É$$7\$$z0$6/bin@/sh4$6f/8F&UEu3p~!p$,@pÍ pyt&UD$$VTYU $($ $(,Ív'U$]u}t]u}]Ðt&E$ųÀ-t#1ruҿe 뼍UEu}$y $1:-…u+:rt$u}]Í&e u$_z$ z$e z$e z$랍UE$ US]$zu&(u-AtO$K&+d(tƌtštt묍t&v맍U$~,$ `Í&'UWVS҉UD$D$ h $l\$\$ D$<$D$D$D$f $4|$$(@t0PD$ D$/f D$<$HuD$D$6f $|$$D$D$hh $|$$XEt&XtG8suxeuxtuހxfu֋Z$W$2\$$E믍&UtED$[$趠Jt&;-tD$]$萠tD$D$Ff $\$ D$<$D$E$NED$D$h $q\$ D$<$D$D$D$h $7\$ D$<$D$oD$D$0i $D$<$D$?[^_]Ív?D$e D$f D$<$D$ (]v'US$eE1K$h*艨,u $twD$@$a$`'+,u $u1=L$[Ee3$[]f1=LfX$CT$6TD$$مxT! t€u҃)ٍA$}/\$$&Yf USt8u[]fD$$]t8u$i[]Í&D$$xٍUWVSED$$GDtMv~vA[^_]ÐD$ D$D$$bf UtE8u A$xf 12$D$nf )kutȃ8tA~[^_]Ít&A[^_]ÐA[^_]Ð@H(]ʍvBHu $AE5]11t&C$4ƅut$ |$D$|f $]C$u1[^_]Å{vt&'USED$$GvtQ t&f~vA[]Ívt{D$ \$D$$f 諞E$T$,UT$$D$D$f $v[]A[]ÍvA[]Ít&'UWVSÁeE1$$+\$$\D$($`B$$w$+\$$$f `B Lt @]Dž0$f Kt @)1$f Kt @(D$$D$K0D$f D$$uK4$4$D$D$D$D$ãp$5t$$D$X$1p($؋Ue38[^_]Ðt&D$ D$D$4$!ЃtV]D$P\$4$tD$${*D$ D$D$4$7D$D$4$۩D$D$ãp$ It&x(D$$T$IH6T$$ND$<$ÉD$I$fXt&v@0&v8tL($\1~$}($\i T$c$~[&($Ҧu7$,($,D$$6Ƌ,(,(?vg8Í@D$t$$uP%=@t(;$Z"7D$D$f $v(T$$Pt&'UWVS 94E&$舼UT$$虴9߉Eڅt $E}UB$$'\$$y`Bt$SUB$$&\$$Ewr1ۉU@R8uU|$$auщ؉DE]܋uȋ  L@U܃9UMȋ2dUg =\ u9ụA]ȋtt&-+u5`t1=$i@ @@Lt ,?tE]ȋ?S EEA7?35t!tf$u ,<ltr8~>1ېt&1lz-D$$< ;8|ɡl$Pl<8t,ED$$GEEt+0 $ӻEUEEE$Mg U$Qg U$=$$(Eu L@6u 1=$54$$} ?o UM̋E$҉Eo?QA$tt&u9҉ljUG؅9uUMȋvvH-uxfuvExt&@>vEԋU܅EȋD$D$g $D\$$ԓ1$t&D=Lu4D$$i Y^05uA$c3pu hHuZnt&믡`BD$p$H$$pp$wE]ȋEEt&D$D$'g $3U؉\$T$$載D$D$|i $D$f $苉EM>A$1UD$D$j $$D$BYg$'US@ t =@u'@Xhá@tx؃[]$j $^tD$j $=?u$ ]t&D$ D$j D$$z$j .t&Ǎ&'U($]u}E11(ui(uX@ ɉt)t#~$SE$D$؋u]}]Ðt&롐($s눐$j 1_@t]D$ D$$E5D$0$N<$E E1t&US$EEt&ut@QEEtcE<A$)((EtE$ ED$$G<t@E?D$ \$D$$j pt'yRG=-A-$[]Í$(D$$8v'Et (i($(\&R AAt E맍vEE$:EA$U]Í@Ut]fj ]É'US]t t B\[]Ít&@Uu ]Ðt&t@]Ít&U @EQ@A]ÍUUu'&t9P&u]Í&1]t& UUtPBTBX]Í'U==|w]=v~.=|=~=$t׍1]t&Í&=v}=t|- v1t&)t&~&;vsf|{c1됍(t&K &;&&+#fKt&' US T)tJ=X &19эo unfXg t5 u   tn tcitpk []Ðt&=X(g t=\g xܸj []Ít&g []Á:=\g 8P u| ng uf농@Ut ;@t] U@}t@]@ UVSt0C3t$KC t`$6u[^]Í'U]뚍v'U p\t]t&$ Dt$DP @ Í'U@@t$C@@@@Ðt&UVSuVң\tPBTB$XFF F@F,FdHF$j A(t@t@t$I&F CF$+F(+F,F0 [^]ÍU$ PTPXPfUS]\CCC @C,CdHCAC$j 't@u1C +C$+C(C, C0؃[]f@tȉ$)C t&$4t̍EvUWVS }t;71t&ݠt":uD$<$u܃ [^_]f [^_]ÐUSÃD$D$$?t []ÐD$D$`$u١L-w$ l @tD$j $릡@t$둡@T$$d+t@g$z$\$$?&US$?$p\$$$t(| u!fB< u Bu졘\$D$k $#x$o[]Ðt&USE]@@t$A1t$$\$$,@E@E@E @[]Ðt&UED$D$P$pD$E D$ `Í&'UED$D$$D$E D$ Í&'U=@t#u&txuɐt&Í&D$ j D$D$D$$ÐUWVSLtxEt 8=-D$D$k $D$D$i$8v5tt fAY1[^_]Í&t@u t3UUv< t< t < v t&u$UCt9D$D$k $\$D$$_u$2(D$D$ $&Í&rD$D$ $\$D$$t$m&ۉٍ{t;uބuكt"˄tD$$j ot։9t!Uʐ< t< t< u 9utE\$|$$ެ&evUS @t*1ېt&$趑@@u݃[] UWVSLu}<$$ ML$?$p\$$4$$Ot$$U D$T$$\J<$tD$\$$ Dt$d=@ u @L[^_]Ðt&4$$t$$5U D$T$$I<$D$D$$ 6D넍t&UStgC D$CD$ CD$CD$C$7=@t6CCt${$s[]Ð[]Ë@x0Gt= p0Gx) @CD$D$ $@C$D$ft&US$ }D$$@Í@D$=@Ct@@CEt []á@xD$$'CfU@D$E$6Ít&U@t8 t(($ t-(-(ÐUVS$̻t% t҃[^]Ë5)ܼ$1($_~($ut-(\$$%54$I4$Í@D$ DD$$(<D$$起 vvUWVSu %FXF\$ lt$D$$芺4$DLD`ƅl,ً! tv$N$\$$@h D$.$ذyr`$$@d@t@TX@@@AlsDƅlً! t€u҃)ٍA$@v+D$ Ok D$D$D$ $D$p$ > lD$D$$譯Ƅl@W$WxD$$D$u ,R$Je !1$t&ȃ $-$E¸$Zp$$~$L=  = C C$p$β($@a@et^@rCk $ڸ#u\S^DCCD뮉ً! tD$ D$@k lD$$϶DL<}fE&4.$Uk <0l8։05 @H@7r-t&&v-($F=@ 0-=dHt|'$D$D$>=dH9؉$5t&4$7t p-@1֋Mu ҉Ue< E\E[^_]á$SۍvfxvdH$=>B BD$$ t&UWVSlE UMt#`t'EEf'EE"Et M M$@1UEEEEEСE@UER{;}|$U؉+E؃T@U؉T$MЉ $EЋUЉ1 EMEȅ"E^ EuEąt #}ȅ}&t vzC;E؍t&|"+E؋U؃T@U؉T$MЉ $oEЃ#MЉ{ME?t&M9UtE8EЃl[^_]f6@%t&&;u&M9Mt&bMW;uƒ}{E u)t%|{;}|$U؉+E؃T@U؉T$MЉ $?EЋUЉE}'\vM9Mt~`|uTt&$Evҍ+ ~| E1 B9M ]' ؈Et|U܍M $T$6Eԃ-}tA}~|ED$ ED$D$Uԉ$CMԉ $KE܅]E]ԉEEt#9EEԉD$E$q}EԅwUԉ$H$lv~|NEۉE{E~|{;}|$U؉+E؃T@U؉T$MЉ $EЋEЉT&tMD< t< t < t&E|Ef;ut&~|EE \~|E~|mDt&EtM|9MEa}"}`w]fj({Ä~|;1;u)E[E܍U]$[D$1E"U EU &Eܹ''D$E$'Eat&MЉ $iD$D$܀ $蝞UT$D$M̉ $REtEl[^_]ËE܅%t&|"t&n~|FED$ỦT$ ED$D$Mԉ $?ËEԉ$BD$E$D$8Eԉ$tEEf`~|M܍E`$1L$`>Eԁ}tgEtA9E"+E؋M؃L@M؉L$EЉ$EЋUԉT$E$ݟ}EԅMԉ $贜A D$$L[=+E؋U؃T@U؉T$MЉ $\EE܅N${8Eԉ$$Eԉ$yEUM1 $}T${EEܹ)(D$E$1EEЉ$跛EtUЉ$蠛Et{U)8EEUܺ($1]}uD$w=t1)t~y|umE$ƋE܅"E|$D$F$E"EDE0t<$͚؋u]}]fE$J(E|$D$F$E)E\E1DfE|$4$D$艘EDn&UWVS 5@t@ t  11t&(u+@u0(t⡴($(t'@tЃF9|,)ЃD$$~u\t0 tO1nEt@ &uGf$@0\&0 [^_]á@D$$$耙&t =@t"t- t&vcvi$b1mt&UWVS@6\%= uރ#P \fxBt*u% |- =hGЃ EDž|DžDEEEfDž|GЋD !E1$ EhDD9|,)эA%hD$$ 1҃|‹ t|'!‰t!|3 DžxtDx\& E~|uA9U1`D$$ -=ttUDhT9D0tD$$蠘1]"Dh EtEExt $O EE\t& J@9/wDD@@[^_]Ð9Уh~D$$<Ã>_u _t \%\=9lj;Jf&&b(& vB\)T(q,u><~|f=\y^|Ã(ttO~ |t8t $D0Dt&5(t>@*+ ?&!&f$^P<G>>DE[q }t =fE/~| t=t&DUt2<A>8P=!(=#t&5T~|0=P@ltl;e\t\;{=P~pE#]t ;]v,t#TT|tJEuC\=uP=t=$t vt vB%\,uc|S$oED$[MAD$$谓Et]KEtuN}\$ D$Tt?UPrr$\ tMAP $tf E1ң@@   4 A4@[^_]Ë} }P_5(=DžhUfhhՠM:u܉D$<$ű\th<h=f===&=t&{&o}&EhŤM MP?=DžlUfllՠM:u܉D$<$ű\tl<tl=<=T==&=t&{&}& lŤa&~|1 BLxEx`8x"Ea&n({[&$&z^vt $v B\et&~|(tBLvP=`=$tfJ\@DDщ`Xe2f=\$ D$Ne`fW~|<( BLf^1~|{'(9 )(U$(D$xO-E}t+UDhT9}rD\ˋut$$]EEDE$觉EE9Уh~D$$e&~|$@$$@Dh9|2D)Ѓ%hD$$\$D$D$ĈEE@fDž|t& t&}P=t=$n*a\TD0g$#Kg !~|]]D$[$x=tUDhT9|%9Уh~D$$DӃ[|$$X]Dz<$/mB D$$ &'Et "t~|Yp9|B D$$MࡤEډ $كD$p-=tO}&u܉t$pD$ E<$D$D$w<$D$E܉$D$&!$EE܋DhD9}9|$D$轈]t<$螅DE9‰h~T$$w량 Mt&\~|- B9M(( $)D$x-=tEUDhT9}hDˈD(ut$$膇]Dr4$]EEe9Уh~D$$1o&D$$t$u[^_]ÍvM[ $]D$xE t~|f1At( u t 1 @2%\ >t&T~|uEЉD$$SH@@hD$$P=!t =#~|-fE}D${$x]ED$$t @5~|EiUDTǡh9%D=X0(D|$$讂U)D<$Ej t&}D|:)EHA D$$,]܉\$ E<$D$D$;!<$~$)$~<$+E;-t&{p {t&vc;}&{E}pWt#t|_t |&&~|}&t&5B D$$茼 {&ff &$vüED$诼MAD$$~kZk މ%\~|(&>|t&<&@t&3%-u<"gBL 5v\$\~e~t~t"v_k  \@\ ~|e \Wt& \` @d=@%\t&)(v#vDD8)DE=P(R\t | u ~|Z߉\LP= >1ҍEdGU@2D$$F@f\<$E@X$zǍ@$3E\$$zM|9 t9 ];ZuV葾$=T~|\\dtB=D$D$ $%wD$`$p+=vñÍ&D$D$4 $v\$D$`$+$]vqppppp\\yʀ\k~\]pq\c\Uʀ\G(;]& t&f/(f~\']#S!t&E  5D$D$t !虵1ң EPDUD$$C@E11ڻ\( (\{h&f;ۍt& &fff(;&f t&ft&fynt&at&'Uf1A dut@w\fɍ& U(]u}5=A(===t&f#ƍ&{D$D$, $*st$D$$q'4$rd1!vxu7$jf3t؋u]}]Ív@8!tÉ$裯@D$ D$$D$6<1=<>t&=t&=t&t~=tv)vtnt&D$D$, $r\$D$$H&$q<$1vjd&$qk $HD$ |$$D$H;5dv#=d)fD$ D$D$$;Opf4$J1%\=@D$ D$$D$:\$|$$D$ :@$艬uu@8=x~|xr \MvD$D$ $pp\$D$$$If@D$D$h $-pD$$x$3vt $hdɪ=D$D$ $o\$4$D$#$$oo15@=@D$ D$$D$!9D$ t$$D$9Nodf1\D$D$ $ ot$D$$P#4$n<$g$1fdD$D$\ :D$D$dk $n4$D$"|4$=fFtpD$D$ $Xn\$D$$"$m)D$D$Ȃ $nD$$e"D$D$ $mD$$3"&'US=dt؃[]Í\$D$$D$ '7É[]Í'US=dt؃[]Í\$D$$D$ 6É[]Í'U$]6Ít&'UWVS1ۃPE䡘5=hUE\PhE \1)t9 @\$$:1)uǡt$k%\x5=hAP u ,$w&<@+=!)L$:t$ndx4t&E1ۣPt$ޅt $2SƉ4$Ȫ4$.dEtt?uT1UE@t \@[^_]D$D$ $jU$D$?P<$lf$bfUWVS,,]u }EdHEYEء@EEܡ E䡄E$%P@ |$$1t \ 11i=)t: t+@|$${8Ǎ&@8uP 藫E,EdHE E裄Eࣴ@Eܣt %\xt#tt},[^_]HQ,[^_]ËAu ,uS$ԟE؋E؋L$L蹦Lt<$ax$聟UWVdS$ @@DžDž Dž C9f  'ѥ'v Dž'D$Al )ѽL$$6D$i|$D D$ $i9 t $:g))C9+ )‰ @p RtH=@@=)wr [ws 9=`} 5~ )ЀËDӉwg$m 44@X@؅tt$NN\$t$ D$A$a3á4~4)‹ZJ)@ YXʋ э=[wf;s H@  0x uR=@R@u;f 9@p RtǍC=[wfs ux t_@@DžS u9 t $[d [^_]ftOL=@@u t@w նt&LTXPPT1iL@@@1@$k 荡_@t @@@Sx  0D$ $HD$04D$ $HD$4D$ HD$C$3D$ $HD$3~HD$D$ B${3LHD$D$ $N3HD$D$ C$3HD$D$ $2D$;D$C$//S:D$&$D$.KD$D$A$.%D$D$B$.X@lA8D$&D$$].á@)@ })s;c SFD$;D$A$- D$;D$B$-P:RD$&$D$t-D$D$C$N-D$D$A$(-yB8D$&D$$,H;P@Y#D$C$)D$A$t)D$B$T)BD$$v-D$$W-@siD$C$(K@5D$CD$C$*D$AD$A$)D$D$B$)X$'A$G*BD$BD$B$a)bCD$CD$C؉$;)<D$AD$A$)B$,(ÃHKA 4uD$ D$D$A$,D$ D$D$B$,VD$ D$D$C$u,&4@D$AD$A$F(á444@D$BD$B؉$(á444D$@D$C$'á4f4Y44@X@؅tt$GC\$t$ D$A$'á4444@X@؅tt$B\$t$ D$A$'á444q@$k 1D$$*)\$ t$D$C؉$-'á464)4@p$k 0D$$(\$ t$D$B؉$&á444q@$k F0D$$V(\$ t$D$C$Y&á4b4U4@p$k /D$$'\$ t$D$B$%á44 D$AD$A$/á44 D$BD$B$/á4~4q D$CD$C؉$h/á4A44D$HD$C$8) D$$HD$ )D$HD$B$(D$$HD$(D$HD$A$(á@@GD$$HD$J(á@@D$HD$C$ (D$$HD$'4@p$k 7-D$$G%\$ t$D$B$#á4S4F9,BD$B$+!CD$C$\!KA uPC$;,CD$S$T$&$D$Q$T$$Au1ۋ Dž}DžfD$ HD$C$j%;D$HD$B$?%D$HD$C$%D$$HD$$D$$HD$$CD$$>"oD$$"PVt =F;055duKsD$D$tk $S\$ 1D$D$$DPL P V1ۃ=D$HD$A$h#á@@%D$$HD$(#á@@D$HD$C$"D$$HD$"D$ HD$B$"cD$ $HD$f"7D$HD$A$;" D$$HD$"D$$D$ËB C: @ tB CB}tB ABVtC B;tJ"1|1ۋB] D$AD$A؉$&á444@D$ BD$D$Bȉ$á4l4_4@D$ CD$D$Cȉ$wá4 444@X@؅tt$7\$t$ D$A$á444q@$k 7%D$$G\$ t$D$C؉$á4S4F4@p$k $D$$\$ t$D$B؉$@á444q@$k c$D$$s\$ t$D$C$á44reD$|D$A$?5$k  WfPvKWv `1ېX1G资1$W/A A D$&$D$xyD$&D$$YZD$&$D$<=D$&D$$kUEt&]Í]Ív'UWVS}t&t#< < &<-t<+t&tE&<-EE0< 11v҈Ut=Ѓ0< w4k UEE܉UEU0Ɖ]uu؉Mt ؉؃ڃ[^_]Ív-1111ȍ'UUu t0< v1]Ív]f UMu9t'/vttu$u1]Ív]f USM ]~3< t,1҄ut&.< ftt&t91[]vÍ&[]Ð&UUtt 9,t6t= ~1v9t91[]Ít&[]Ðt&k  U?|BңtÍt&$< @ @$ @$ @ @$ @ÐU]}}utt؋u]}]fto~m$^~;1D$$P9ͅt{t&늅&at&Rt&'UVSE 5(](tv;~umڃta/t$t$D$$º4$@ރ[^]Ðt&D$$뵍t&US];/u{tD$/$?tX؃[]ÍUED$/$ɅÍ'UxED$E$D$=1҅uE1%=@‰Ít&US]$1҅u[]É$D$1҅ƒ[]ÐU]]uut?t[C3F3 t ]1u]ÐCXS\3FX3V\]u ]f]\$E$D$8DGt/VNu:ft.Gu_u捶_t&u뿍v덍&'UVSu=DAu)_t$U ut&1҃[^]Ðt&[uvt=t11[t>t&+u|=taAt&u_vuЄt=t[uljT$4$[<]uLP+t=o&e]|=JP&=t&'UVSuFt#0< vO&0< wAuD$D$̃ $7;\$$1[^]ÍM u[^]Ðt&$ut&뗍UWVS,} ut G6ÍED$ D$ D$4$x:ۉE؉UuhM ut&M t ttA>t6ۍt&u.&t E؋U܉W,[^_]Í1,[^_]ÍUWVS<]eE1u }E&$t$D$ D$ 0$t$D$ D$ 8É ؉uu uD$ |$D$ $%7Ee3u<[^_]=&U$Uk ]}}uBt\$8;~MD$|$$?u97uA7D$D$$6~v]u}]Ðu$Yl؋u]]É4$-$5lt$$-؋u]]Ít&'UWVS1ۃtit&뎍<;u9ލt&s)4$މD$D$LE}uE뜍t&E썶놃}fu{$&CiuU؅PMEɉCUS UEU܉CES$ ] E ,[^_];}vD$D$܄ $m'D$E؉$UBD$D$Z $:'\$D$E؉$1A,[^_]D$D$= $&D$U؉$D눸h xEh fEh TEUEEEE$ÐU]Í&Ut0;}Ã考D$$ff?$]gÍUWVStd{%c&D$D$ $%щT$$M]uUe3<[^_]Ð&t2u {ft0$g C uɉ$twƅuЅt<$g v$ u<$ [^_]Ðt&C RC cljT&Ug S]CYK t$g &C [][]fUWVS-Fxyu] vND$ D$D$$w ^ M$g F [^_]:f$X $ tt&둍$2 \Fo$8 DF[t&^A$ F@$ I^$< g C$j C g $j Cg $  4<Cq<)k ^ t&[^_]ËF$eF@$f{v^$t MC=S$g $ -&Fk k^C$\ D$D$$p@$m ^<C $a8 !@<)- $hSvF@FX |&;&$D$D$ $\$$FPu^$%$k i <Ct&F$^$G )C $K  <C<)C t-OR u<C <)"k HvFk S^C$ D$p[ tm<CC a$5<C<)k u<)Zk =t&^$t&^v$t&cv$ <t&x @ @@s=<)-Jq { ;vÉD$$X 5&uF1ҋ@$g FPvf$ +<ftmf$ FPFP t<t $ nFP$ $g $k EvUSÃT$$ky'C$ <C<)Tk []ut&UEÍ&UWVS E<=Ut 8$ XUt <$%E $:8 t[U-=< Eu { S4$& [^_]Ít&X @ @@E-ۉ=<tq  )^ 댍t&$ d<m D$$ky8vCD$$NUWVS<$ eE1t8uUe3<[^_]ÐD$+$x$$YD$-$xE]ЅtUЀ:tMЉ $D$.v>EЉ\$$v(@v MЍED$ |$$L$UпEEE߄ 11ust95MЀ9t6t+b& MЃ9tHtb~Eƃ$$vU߉|$T$$CEqbW&kv1ې[t&'UVS u\$$ D$D$$ D$ tM1D$CD$ D$D$ $ t3g uŸ뾍D$D$$ D$ ' [^]ÍUWVSE UuEEU}E \$$ D$D$$ D$ Eu:t_fEE E E[^_]mD$D$$ D$ GuUD$kyD$D$ $ ?D$<$* _to?t&tf<$D$ UD$jyD$D$ $0 }表tU:uE蛆 D$E$ t& 듐 dUS~\$$v E@D$ D$D$ $ []ÍvUVS ] uZtJFt;uRg D$ D$ D$$6 6uE E [^]ff$舥tL$謨҉øg D$\$ D$ D$$ $" 6f$ШuNg D$\$ D$ D$$v 6;v $D$D$谨ɉøg D:t&\$$t&_U]uu\$$~FD$ D$D$ $D$F $]u]Í&U]uu\$$FD$Ņ D$D$ $8D$F $]u]Í&U(Euu }}]EE>uPt$ED$ D$D$ $]u}E] &u4$ftN4$&É\$ED$mD$D$ $P9tt$ v농4$HuNt$ED$mD$D$ $A\$$t&D$D$4$(=UE D$ ED$D$$ Ðt&UVS]u t2tD$C$ D$uԃ[^]Ðt&UE$D$i$D$aÐUM;}7AAAAAAAߡ ]ÉM]H&US]t$;};CCCCCCCߡ[]É][]3HvUWVS ]tI{ 3w+K /|utC$BC$C$/u [^_] US]t:Ct$Ct$C t$][][]fUVS]uDh&CCCCCCCߡt(C3$p;|$Fu؃[^]U(}}]u&G t$ v8D$ D$D$$ 蠹}]u}]t&$ _C$C$w$뽐t&G@$ZG$띐t&GE@$EX u)vC$C$3$JuڋU$;&;v_C$Z$t&_C$:C $/C$$C$$t&_C$C $C$d$&G$ut&vG$t&sv_C$C $$CJf_C$C$C $$&]u}]ÍvUS]C$C $CtE[]t&[]fUS]$][]Ut t ]Ívu6t t t t&űB]@&Í&u뿐t&UWVS,]E܉U؍UeE1ɉMEEUغ U)Ut&Ǹgfff))EЅҍq0 8Gu҉1ɄEt*M1T9f}܉ 2ux}غ)k<)ӋU m gffft&Ɖ))ÅҍK0]ЍF 3uׄt&}ЋUUD7 EuE؋ut:}.E؅~(U < 09]؉U }u؋Eԅt E0sU܉2Me3 u,[^_]2&'USӃx$Ox$C[]É'UVSut7~11&9~F<t$F9[^]ÍvUD$]ӉuD$؇ $\$t$$d]u]Ív'US]Ct$k][]^v'Uܼt Í&D$$D5$ D$$$5$ ÍUS]D$$V][]I'Upt$)pÍ'U]Éut(D$$~ $t&gt+vt.D$4$xjuF4$v7]u]ÐD$$Xy݋]u]]u]Ð1҉gft&넍USD$$  u4[]&Í&D$$$t[]f$-D$D$ $\$$_둍'UWVSÃUUEu B E BB 61 (E,‰օtuYU$ӉEt,uut UtU$ I%E[^_]Í ut$ %D$$$%qf u u$ $d$  %t&^v$ k%D$$g&EEu $ -%D$$hEu %h D$$#$hU$}]uU A@ <$$Au;HBt$$$8=\$$HBBtu4ED$G$蠾É։<$؉]u}]ÍvE11tًE11ʍ$X%vM11tE11뢍UWVSUE] e5u1T$\$$'"([hD$$T$Ju%=@T$ D$$zxK(D$Pt$$Z~ (#)$$藲!t&2$t1~ue35WČ[^_]f($ /D$4$|(D$PD$<$h<$1z~U(t$$ˮt?D$D$\i $t$$ɯ~*&sKhHd%fv;vC@t$!,+Au $$蘉$Ǎp@D$ttL&uC8-$j=?t8=?~"f?$Y9=??$D$5???<D$$@ D$D$f $0t$$ at&@v)!4$(< < ;l< fb(< t< t9~B< u؉ˉD$(\$$x$r2| D$D$ $#\$T$$艬$~R&C9fֈ ,<q<@(\`x,UӉ|0M$E4E8EYFNx |&8vFP\$E|$D$ $D$!x<$E}${$$* CFp>Fx |t&E$;GM U9|B$HU ËD$CD$B$SE$* u\$$ %\$$x|$$E$D$L$$F1ҋ@H&tHU T$M|$L$ 4$D$x<$ D$T$$,[^_]Ív$ 臠T$D$$CA ,[^_]É6UWVS}u #++Rf @?(?(LW =ɉEt tW u ੯}tt<$ <$$$)\$$gt$$/ UE}1Č[^_]Í}uuҍt&+Wu+u@(($(@t&UEMT$$6;t&D$4$ t$*1v t&G D$$ lEEt+$El$KElEpEEt+$謓Ep$ EpEU UU}tE$D$}tU$ T$_(n(Q *D$ D$D$$e 虙Ef}tUD$$GE$<} U$'$@  Et 1}E܋ w E܉$ceU܉AeA0UEMT$1҉$g8GP @A੯W 1$yA$\ $@ | t&Z.($$9Uҍt&tA[tGw+EtFHVA@ Utt +FUEE3 ]f(vw(F$zEܡ(a(1++t+SUFUSE-UF U4EEӣE2J(ۍvtGEԉEwAk Ft t +4$G$Au;HBt$$$-$\$$HB7EܣAEԣE죘etGwA@ E̋Fۣt t +F$$Au;HBt$$$P#\$$HBZlF$aát$  $$!ƍED$4$胤EẺUC;0t4$*$^uE,U UEGP @ZEOUȋ_S |1 G & ;v7 D$ T$D$$R :$ntGG E$BEԼE}Et G1҅tWGt WBUMGT$U4$ E܋E죘eXt }u$}ftMɐuU܅t EܣA: ],NA4U܉Al$PۍjGPED$$D$ED$ ED$E7tGwFH$ w(w (Y Ft tH$e EtGG1EtGGzEtGwFU4$2t4$$AuE Fu;HBt$ $[$\$$HBD$F$eA $sE$$2U7E$P D$v u(t ($0(tUR҉Uu"({EExUD$B$荜Et@tt 8M$t=(4$Ѓ =x҃ ‹ET$D$M4$U$W(C($F1tGwD$EF$O,t5zE.UEMT$$e+$1l$lA}vv& vpD$$&($>w($,ffEE-+@UE#3EEvUExEE9ԼD$4$E5Լ$k((zF YE܅NUBt EvtH$E܋E$$2UF+EF $訓$k EiU$T$tFHEEEyUD$ABD$E$_@@GF$҉E](>(#++t+U؋҉U((F4$ux$AduE Fu;HBt$y$$\$$dHB҉E?4$t&;vsv{v?($  \t&($ t&$Bt&CEt&ff[U҉U%Ex&CtH$Eܡ((WB ==5E܅*uȅFB1҅tH‰$EG1ҋ@HEOUD$D$E<$T$ D$D$F $ R 5l臶t$ t$$}l$UȉEԡ$Ľ` ft5l$ lt$õl}}~B}n}vkE}؅t*5,t]؅t t4U1ۉ$5E${$UT$$ML$$n'至B[4$ƴfLEE8@an uE>翉>>c($IDMȋA$ u BEE}{EQE̝u萳 l$޳lE &KvUE8D$D$$ 9`ۍv2A$-$ ,}EF $耷3vEt&`}t&}vvEvguFt&U:@M7D$D$E $UȋEEQ4$ƪ5pp=+ R Et4$蕪p$ pl,E$uv3%t&$Et&Mԉ $t&A$$ +Aʉ $ʉ +9D$<$+E}Eq ƿ 8fCD$ D$D$Eȉ$C4$T$D$$ƿ܉ 8uȋFe&UWVSÃ,t҉M)xE; EtECt'ȼt UyAb]t&[vvE t U $虮EUEEt AoC t*D$$C $C ; ]Cy EHCt UJCt 9]tEHEtUO FEU@EBAE UD$ D$D$D$$UE}؃-t,[^_]Ðt&1}Ab Aѽtvfvx&uVE&v}؅o$Q[AI&}u@ $_{EQE@H@8@@vC $$A蔾&C@EfD$$ Ah]E@Bt&vkvv}t& Avv{t&<$fUWVSÁu }8U$4eE1|$JLL$$$D$$S4%CEL$X$Ph$肧`'`Q`ꋅ`)kd$)1D$Ed9pdt&w1ɉt~t~u\t&U D$ ËE$D$lU t$$Z$D$]u]Í&4$|랍E $ËE$D$ UED$$E D$Í'UWVSEUM‹}։ӃNB;E=Uu]MGt&UtM$L${uڋE$[^_]f$R$\$$yt&BD$$O"5UWVS}tE8u(EuFEE[^_]Ít&ExtҋUEzt‹M $蜎E벍v0t1u$1EEubt&U:ttFtAMu$5$f\$$ΎUMFUuUE<$荋E[^_]ÍM\$$L$Iq낍t&'USD$D$E$]øt$Ct$cC$ $1[]Ð&US]tzCuKuWCt$̊Ct$轊$賊Ct @][]閊fC$E뻍vC$Et&릍[]fU]g&UWVSE ut&[D$C4$D$>t؋P҉Ut%EPt@ tMA;ti4$5$ft$$ΌËG$豉<$詉E$$B$莉1[^_]Ã[^_]ÍvUBt$YMAA%= AAt$%E@Us$k$\$$t$D$$ MH$|G$ň<$轈1[^_]ËA$tJ UD$E$&Ít&USD$D$E$}øt6$L6Ct@u)$1C$$1[]Í@΍&UWVSED$$K$,$]\$$ŊEE8=D?D$D$E$胆3p(Ft$UE&UNFFVt$&FE$tU1:utD8$UT$É$;=E8GD;U^@:IE$襆[^_]Ít&UzzUzhE$ňXt&UD8+E$Z@@ft U$c>E$ 1[^_]ÍD$ D$ED$U$f{%zF zSfz4$&vvD$D;$蔈vD$UD$E $Ev$E'U(uu]}} 4$t%$u] ]}}]~2_ G <$2_ E4$$'t$$菇\$D$$藄UP]u}]Ít&U(}}]] u<$3@t$FFt$}t`$x2FV ЃɉVt F‰ЀFt @$L赝]u}]ÍF뢍&<$5$|$$t$D$$臃E]ƋEp-USPEbKC؃[]ÍvUWVSLEeU1$j E @@Epx E ‰Ӊ11 9-Uԉ$UЋtX1ۍU1U̍t&UD$ $T$T$\$t$D$ Eԉ$GuUe3L[^_]Ë] ~}ЍU11U̍t&ED$ D$T$$C\$t$D$ Eԉ$9] 뇍&} t&UԋBX C$芁UЋ$T$C@Eԃ@E111fU܋R BU܉$8UЋT$$JU܃BE9p9} UЍE11Ẻ}U؉UĐE̋UD$ D$T$$#UĉD$ E؉D$ET$$oE9} Sv9X '&cv$j t&jv9v| v1#vt&'UED$$DDÍU$]Éu։}t]u}]f$hp uxt܋U PԍvU1Ut Bu BÍD$D$B$ÍvU8E}} ]u@tu]uu:<$t$^B}tCtEUԉ$T$1É؋u]}]Ét$@$!BEЋEUԅuߵ$賵v1ۅtEuL?u$&;땍t&<$$|$$腁kf$E>t$E~tE~uV1?tt uK؉$蚿t$É$U܉|$$u4$'ÉE܃똉<$ U(EuƉ}ω]UtDD$ËE$D$CtKCts@gD$L$$<|tXtCCt$ }CE u2UC$D$D$ T$ЉÉ؋u]}]fU E$T$D$bƋC$D$D$ t$9ut4$|t&륍C@tt&t4$4zvcU E$T$D$ƋCt$&|CCuCt$ |st$ D$D$C$4${mUS]C%0=0t][]fcSHD$$¡;tC B][]^c US]CtK,u t:SHD$$J¡;tHC B][]t&c&Uuu]}=_tYVD$$¡9XtZN 9XtAF B]u}u]O&;=t0$wÉG댐t&Hff뭍$wÉGX'UUB%0=0t U]f] v'UWVSEu} ۉEtfD$D$4$xtNXtGCt$Zy<${$|$$K|CCt$)yCu Bf[t9C t&tD$C4$D$wtӋHt̋KHEEE [^_] US]$t H[]D$D$$ uԁHːt&Uuu}} ]4$3tD$D$4$1ۅtBÃBt0D$|$4$4tH]u}]Í&D$|$4$f4$1ɉt&뎍&'US4]eE1ED$E D$D$ D$ $ $D$Ue3u4[]Ív{t&'US$ eE1usE]D$ \$T$$QD$$} D$E D$ \$$T$D$$ D$Ue3u$[]Í&G{vUWVSE$|tP t@;u_EtCt9CtM[uD$1D$ $Dv$(-[^_]ÍVEU뙐CF@&t FSENjEugFGKO GE8It[^_]fxFuxSuxu<$tt&CvV[^_]ËU$qw$袶UT$$xGlvKD$$E)L$frCv1E1$ UE]u$t@t ؋u]]ÐƋCt$>tK؉s]u]Í&U]]uu tE$t]u]Í&uHE ]E] 봉'U(]]}Uu} CcuaD$D$ |$$ЋCt$]sCtKCt @؋u]}]ÍT$|$$D$D$ $ƉD$S9tt4$rvsvT$|$$xƋCt$rsG UE$t Efɍ&Í&US]$;Lu{AtD$$wg[]ÐD$$ffU$H ~t8u ÐD$ D$$qÉ'U$O .t8u 1EfD$ D$$dqx׃t҉E&'UE$t1 :tBt Bt?fÍ ! ^?#ÐUWVSE\H$btl8tgEjD$$E []]jD$$[]fD$i$D$i$벍USUu []Ít&tCt@u$ 捴&'US$eE1-nUT$D$ T$$$ [t`D$\$$ kHEe3u$[]oUV1S$Uk  tp$ t fxt $ %t.D$D$$ H@$ujD$D$$ H[^]Í&XmD$ D$D$} $*E$5t&덍:D$ D$D$} 4$K*4$D$t$$ H@UVS0$ eE1t 8bEEE]ۉ. c:t&غQD$ D$ )B0kdE)Ӊ$t$]u5D$ D$ $t$0E E0EI&D$D$ԋ $h\$$!C0EEED$D$$ HEe3@uh0[^]f릍t&ED$$a-t&غgfffE)B0)ӈEC0EclU8t Í&p8ɐt&Í&UWVSl]eE1D]M ɉMt>t&UUfMM…t=u=EM ɉMu`B$ D$cD$ $_BD$Hg $ D$Ԍ $ zD$D$ $- $D$׌ $܌ BD$e $ .D$e $ $ D$=t'5, D$$ H$XcD$D$h $O H$D$D$h $H =(MuD$L$4$XH@}=CE$6b$gUT$$bC3{/"$ $aǡ$aD$\$Ɖ$ZbD$>$Cb E $c *:fx,$w $ $Mg D$$Qg D$v,p;/S4$`$\$$[a}  E$`UD$豟ML$É$au3 }D3$|$`ED$$D$U|2?)M $贾TH@?)U}D:8(t&$趿$T4D$D$$ v$}_$Uk '=ofgv$KX4L$!_ZD$\$$ H$f K@ @`HP$f 腾D$\$$ HeD28(k&\$ oD$$á8.tD$$f$m ܽ&&o`ve4"d4;d4$]D$D$ $[ut$$D$$Uk D$Yt&UE D$$W u$_@EÉ'U$]]u^+@$T$ƋCt$eZK؉s]u]Í&'U8]u}tE]u}]ÍE$]E@EE~111f\$t$D$ E$设9}뙐UE UD$D$ ET$$YEÍt&U$]]u}BƉ$NjC$+4$R؉{]u}]ÐUS3]t3C؃[]Ít&)uH$8U]]u$T$ ƋCt$Xs؋u]]Ít&'U]]u U$T$軿ƋCt$~Xs؋u]]Ít&'UE D$ D$$Z$+\ThEÍ&'UWVSÃ,$$]EEEM1<4$$Z$Ut$$ZÍ&U܋E9pt+1t$Y$\$$ZUBEEE@EUErUEmUBuEptEUEU;p9UU$UY1>t ~t~D8$\ËE$D$Y;=>uRD;EU,[^_]ÍD$B$D$C9D;t$$TYv4$Xct&'UWVS =@ 5t4$5 1ۿtQ1tBIÅu{1tB1ɅtJ;5D$$ơFFt$$־t+$5Ut 11҉r;5t4$U$tP@ [^_]Í4$D$ƣ45gt&$ܽt$Tt11҉{vUtEAÐUS]$\)SP[]U$]u}賕_ 1҅ۉƋGFGFt$)‹CBGV 1҅t‹GV1҅t‰V]u}]Í&'U$u}}]"ƋGFGFG F GFGF w'O /|t'_$Z(SPF]u}]ft_$rU$裔\$$ VFfU1҉V1S]u+vƉ$.0utE[^]:f[^]Í&U1W1VS utDt&^$'SP|$$I!6uمtt} [^_]x: [^_]Uuu}} ]^$>'SPV G1t$G ^FG1t$JT${\$$TG]u}]Í'U$>D$E$OÍ'UWVS utP$NjFGFGF G FGFGFGF t $;G > v [^_]Í$ &FG [^_]Ðv$yËF$(V C1t$C FC_넍t&F$Gkv$ËF@ C F@$CF@$C_ [^_]Ëv$ёËFCF$zCF $lC F$^CF$nC_vFGv$ YËF$CFC_ut&^$!ƋC$FwG&^$ƋC$FC$S F1t$F wv$ 衐ËF$pCFt&^$qsEUCB$#Vs 1EPUBuUZ Wh]$ËF$CF$CE6uȋMt$q6륐t&v$ɏËF$C_t&'U$]u}胏wËGC$"VCPG $C G$(C؋u]}]ÐU1UD$$!‹ D$MÉ'USD$$dJE D$ ED$D$$M$ D$Q,uKD$D$ $+MD$D$$bJ$uMIt&CtED$D$ӎ $L\$ D$D$$Jl&̎ 봐U1U ]]uuD$!‹ $D$cL]]u uE E]Utt8ube Ív$f ܭt0@t*@t&tD$D$$uf`BtɍÍ&$ tɐt&Í&UVS S áUD$\$t$ T$D$ D$$HED$ E D$D$$K$ D$O  [^]:e\$4$}RQ u UD$t$ D$ T$D$$GOt& t$ D$ D$$G$VU(]Éuۉu/t$ D$ D$$JG]u]Ít&uE~ u t$ D$T$D$ D$$F]u]Í&'USE1;E D$ ED$D$$I$ED$D$D$ $sF[]É'UE D$ ED$D$$aI$ D$lMÍU1E D$ ED$D$$I$ D$M$T U E D$ ED$D$$H$ D$Lu$qTUD$D$ $GUT$$oÍ'UD$D$, $GUT$$/Í'U$D$$D$aG$.vD$ED$Ít&UYC$C$.vD$ED$fUSD$D$A $F\$ D$D$$DE D$ ED$D$$*G$ D$5K[]ÐUSZۉډ~ft& @t$E @t$E $EZۉډ$E([]Í&'USÃT$$$[]Í'UVS A tZf tSta:t\۸ޕ taT$t$L$ D$\$$ 3D$$@D& u uۺޕ u떉'UWVS<2= ?E܉UӉƉߡ  Ã=tu <[^_]Ð=t!D$D$Ԑ $D$|F$譅\$$GETƉ׉4$|$á($CU$Ct$C<[^_]ÍvE$E$\$$FE}+EUt&Z}& f }%} |} f$t&BD$D$ޏ $#Czt& &D$D$ $B=E E(-(Ɖ׃= :t!D$D$ $B[ U U(-( &En}/t& f}^!}|E] Ɖ&Ɖ f:t&fv Ɖ׍&MvD$D$ $Afu}f3v}*t&UE։UԋUUuԉt&}-+u}vU UEU4$|$D$T$ ƉE]11ƉM 1U Ut|EU4$|$D$T$ QƉXM Ft$=  AQ AA AA$ AA $(~=؉[^]Í&D$D$ $=2fD$D$ $x=:f D$$ ~fD$D$ $(=v'U'WV@\(D$$@Dtat$t<t$c<u 11҅t E 11İ^_]Ít&EM t M \@'İ^_]ÍUWVSlu' t t vj&t6ېu֍B  l[^_]Ít&-E<_EAC< vqU:փ<==pt !x>E}uĺ  UUAu#t@tހ_vtփm]ċE]EE <071U1eE̅w>v!D$D$, $i:E1u1U UԀ#t]_EP}@>E>Et&;E&EЉE]UMٍ4u}cu t!&]]Au_tmE0E[Et$9$a;$z\$$;]ĉE 5 EU(=$EEĉU(  E5 =$ EEEE(C;}]$0t @}]$r/n$n&A< ;EЉEED$D$D $7&D$D$`$7fBEf11E]5 =$  ]ĉl[^_]Ã= $  뼡?$6U]E5  U]=$(:D$D$$5}]$裶t 8v11ң $>D$]ĉ$軫EȀ<]uy\]3E]&|&*&-&0+& =t&C<]$ t&A<AfҐWuĺf$D$D$ É$W$54Iuĺ >==  u#uĺ >=  uA<v}%E7(E$j8= tatXt4 t t t&&~Ґt&u1DAu&_t!N1<-‰uă71<-‰uă# tyA߃]w5$ |$$] "= uwਫ਼u)D$D$@ $25D$D$ $2 w@}?E?EEEs<|Wuĺ'&?uĺ*'uĺ UWVS Cw,W&+& Cv--uvƉރ߃[^_]Ít&e= 1҃t É 5$$t$6ǡ(u o<$0 [^_]Ã(Cv_D$11D$ $0B[^_]ÍD$D$l $0"f5 =$tKb[^_]Ql= )ƉtD$D$f $W0뵡((EEEE AvJE 5 =$E(EEE1҃(t $T$W (ɉt1$/ Q$.D¡^U !t ~t t& 1Ív'UWVS,=  EUui~É ؉x_ރ1ۋUEӉUUUӉ]!uӃ=  M]tEU,[^_]Ít&D$D$r $ .w{fEEEU,[^_]Ít&UWVS,EUt& *E/E}tn%À}Ɖut t{f}t&}tEUt$|$ $T$ EUy}u%&fY׉Ɖ uD$D$Џ $-^}jt&MUEUʉEUt&EUt$|$ $T$EUvEU,[^_]fUVSEUt& +Ã-ۉuu EU[^]Vۍt&uft)EU붍EUUWVS É֋= Gw.f t/ t= Gv҃ ؉[^_]Í t1UWVS EDvcnv19ֹ|&9Evv 11ۉMދ <ǍCvu>u6v19ֹ|9Evw릍E [^_]Ívu+19ֹz9E&nfcvɍt&t19ֹKA9E6f+t&'UWVS lj֍ Cw:%t&t6vu֋ 11 1Cvf [^_]Ít&11 1UVSv= &Éu^!!փ= &t؉[^]É'UVS= ^Éus11փ= ^t؉[^]É'UVS= |Éu3 փ= |t؉[^]É'UVS= ÉtNg&(-(щ  !ЉƉ= u tKѐ؉[^]Ð&UVSf= ÉtB_&(T?-( 1= u u&ƍ؉[^]ÐUMt%19u $t&9tՠu1]Íդ]Í&U 8, $] 1Ut5XŠuHPƁXo]ƂX;ƀXùۍ'UVS1ۃ??$g 1҉1t+&դt  ՠuމ؋ ?tcC?ts[^]Ðt&US$Mtrt@t#19u :f9t1ՠu؃[]Ðt&} +uf䍶դtӃ} -t} +u1} -Q*w$ } -ut$0뒃} +u+0v끡te$X} -Mf;v>@ UD ]H L P T X \ ` d h l p t x ÐUX]ÐTU%Et TX]%ÍUtLUtH]Í&'UWVSÃME~d=L1ɍt&tIPf9t:9Xuvtx ftxfuދ]ېtU[^_]Í&9M[^_]ÐUVS˃t TtCM9t29puҍvtx ftxfuލ[^]fÍ&MMۉt1tԡL@[^]fƒU~]f!]Ít&'U%]ÐUܼU9Љܼtt P]Ít&'USÃx$%Cx$%C[]Í&U̼]뵐t&UD$к$VÍt&U= tD$$^V fUuaܼuÍD$$V%D$$V%D$$U%ÍvD$$UD$$UD$$UD$$UÍ&'UD$$fUD$$RUD$$>UÍUD$$UD$$UD$$TÍUWVS t$6D$$%$D$\$$$x&  Lt9z t=yD$D$$# [^_]Ðt&̍t&US 9tO ʉtELt>x tlx u8uML9uLx tȋ @ t'1u[]Í1҉ڐt&U ttLtx t[tLtx t>*u+1ufɉUWVS udLXt!9ut&9Ít&t…fuӅtD$D$$! [^_]Ðt&t$tD$$"$t\$D$$!K&UWVS t$T$D$$"<$<\$1ۉ|$$F!5~* L11ۍt x Ã9|$D$$ [^_]É'UWVS }t$$D$q!4$\$t$$ t*~( L1ҍt&ttx uH9t$D$$H [^_]É'UWV1Su[^_]Ðt&t$D$$ $T$\$$~A1ۍ&Lt!\$ |$$T$u 91D$D$$L[^_]Ít&'UM ]uuE11uÉ؋]]Íx$$D$4$t$\$$E11t$D$$؋u]]Í&'USÃ$St []Ðt&\$D$ D D$@D$$&L &ƐU$ ΦtÍt&+t uD$$`-`uȺN 'UWVSÁUM}1} M9+t19-D$CD$ D$X D$E$B}LM @EfEE9EEuE}]E@t&U$ T$)} }]ۍt&RLM`%n @ N ,tUB<iM`%s M9}`%tE1UMċB ;A Gt{E$D$;{{t{I)D$T$ D$ D$U$MA<t=t f]9}t,t(MD$D$$D L$ GtU$T$#9}EuJ}tD;MLE H u @M \$E$u}ft3t xU$ T$9}?9}t'c u` D$D$M $uGD$i D$D$ E$vUE.fLU`%n }@ MQЃDƅ`%&,D$D$ D$@D$$&Zv$|fvv`% vED$D$$Е D$ }xM $lLM HČ[^_]Ðt&$D$ŕ D$D$ U$t&B;A&v^`%[t&ED$D$$ D$ !ED$D$$• D$ L/fELE@Č[^_]f`% &Done&v`%&$,D$ { D$D$D$`%$EE^&L@@D$% D$ $D$ Č[^_]Ív`% D$D$ D$@D$$&lUUEt&'UEtU;B t 1ÍEU /1Ít&'U U E] t&'UWVS,Ll_=%t4$lD$4$<D$4$,$D\$t$$PDžDžv=LtvCui58K1҉fpu֋9uuC ܼuf t\v9O=%aD$D$$O,[^_]ÃtSfrv&t$  ut&KʍvЋ9upAtt&BH"fC vvÅtx to$uWu\$D$ӕ D$D$ $ =L=L@ܼ 1ҋ=LD$$$D$ D$D$ $1 =LHt&$ D$O+ 1ҋ=LD$$SHt& \$$ $ D$|=Li1ؼ;P|t&-%,[^_]Í%G"f 1҉g&c 1҉/&D$D$$ D$ UWVSLܼEEEEc&AO%u}t(3E\$D$$ƉǡttU8%~ t%R(M}t E-Mu&ҍt& ;z&uE=BB E LU؋ܼE4M1ɉU1ҋ^fEԉ] f;]tB1{  ‹C<uMԅtMЅtĹtt&1ɋ M̹;]u~ EMMUM@ tU %uC}u=UE7ܼMt JEăL[^_]Ð~ܼU1t&($?($?ETt&vɍrUMF  `E̅8EEM؋z |&KȃzMU؋@|&$8t CA%$%$%A t1.nv$vӋLU8 ]ąېt&Ev'vUF Et&}t&8Eܼ$EądF$ $4I\$1ۉ$ $ (0D$$A$1D$$A1D$$Լ0D$$(0D$$%0D$$T0D$$&0t$$P L/t$$0,[^_]Ðt&H; uX{tE9Xt<{ u|$C$C u tNvtFLE9Xu1lt&Dž|$4$HEt&D$C$I륍vtStN y & &Q v9t:xu@ t&捶D$A$ELfAA AUVS5~n1 f9~]L4t@uD$@$EL0x uD$@$!9t&[^]É'UVS~g1v9~UL4tx uD$@$LD$0@$9v[^]ÐUu!ȼxD$$LÍKȼxD$$UPt-;t%D$$ PD$$fUWVS 5LH9t 9uZ9%|L4=%u^1vCE9Xut$<$v [^_]Ðt&D$%$:5L%%뉍'U(u!+t= t|&Ðt&AA+t= tA(((u(t/|&Ð($3.֐$ft$B=u($%FD$$H &USt'D$@&D$$+x#1[]Ív$tōt&tЋJ$* \$D$B몍t&'UtHD$@&$x( Bt7D$D$$a1҉Ív$?u1҉USHܼȼ$$9tD$D$$D$к$+=ܼ$m-D$lqܼ[]Ív$O$D$D$$薷uJjv;tQD$$*D$$\$$*$ļuȼ,;ȼD$$;ȼܼ;ļuD$$8ܼPD$D$> $+$'fc0Z}ܼ []$ Rȼܼ($D$D$$ȼ$D$cȼܼ$ ʪ$2&'Ut$$Ív'U(uE]u } E%ELU<&M9=`9=d$&GJ) Gt$<$5L ]E9t9u]u}]Q]u}]ÍvA#ULU9ډut&z&E1n@[$ 3‰Xp@DDH;H~0@@$H;H֡L6t&-)Ѕ]NMLMMz ZD$D$@ $g\$U$T$=LD@HӍH!9ى I#t& %9'J9ɉy܉؋Q9|K9u7t&9ʍt)9ʐt!19!‹%%($St&=Lܼt@t؃bV$Z+(=L(t&@!'&D$$Au$tG=LDž$ D$W$ =L{L$D$$D$$$tD$$Y^{=Lt& t&'UWVS}t$7D$4$$D$\$$L@ w] ulthAD$D$ $bWT$\$$;1D$D$$[^_]ÍCM L`4X,g ND$ GD$D$u $sL:&CtIL$ D$D$ $AL29Xt%2C ;BuCuf밐\$$$ u8LP&;PtzuB ;Pu@ U L`YE ut&Xv1҉XD$D$$$á%@&%D&%H&%L&%P&%T&%X&%\&%`&%d&%h&%l&%p&%t&%x&[^_]Ít&iLHX9=Ԍ 9=r g t&LHD$@$A@&%D&%H&%L&%P&%T&%X&%\&%`&%d&%h&%l&%p&%t&%x&%L@D$@$Xv$D$| $D$vD$• $LAD$D$[ $ \$$D$D$$2DžVYL=1X11Dž1DžJ UTt̼PhܼuÐt&$̼@u$ ۉÉ'UX̼$ܼÉ'U]XM'XUt]f]X UWVSp$D$$D$$<$|$\$$ptU t~$2!#tH1u;9|7 ܼu-t&Pu>P2v5 ܼt؋PBP4$D$$TUۉىp@@ PTu ы9uE t5ؼ~_1҉M茭tLLx D$D$ $\$t$$Et@H;B5ԼD$|$$[^_]Ð$%D$D$@G$ܼPuPP;藯P$D$*E uP;t AB;Pмx$м̼x}}̼D$|$$uZ8ft֍Fvv5Pt&Pu P谮̼6} ؼ[^_]D$$(*v$ 蔅Ttt&v9ƍ]D$$QdP\$$ D$_U1ɉA`Bt u t t&u]ÍvUS1t A<;v18[]Ðt&$| {(u۸[]vÍ&1:SƍUS1tH߃;v9[]Ðt&$l {(t&u޸[]&Í&1;SƍU1]É'UC]ÍUSÃ$tX@[]Í&@[]ÍvUVS]$!$Rۉt; t4 t t\u u[^]É'UVS]u;S~9ӉrJv t&t@ vt8t&tFvu>AQ< t< t< u.9ˍs u€Bt9rvQ؃[^]Ð{St{o$ T^맃f&'Uuu]4$1Ҁ|)t]Ћu]Ít&X\$U 4$D$蘸‹E Ћ]u]Ðt&UV1S`Bt$t$$Ι u׋t&t&C$t$$蟙ۉu߅tt 4$ղƃ[^]Ív'US1ۃ&uNt&&t79&~,&<t$e&-&&u&[]Ð&U(}}uu ]tI1E?uQEM)9}yU|$$T$M<$]u}]Í&EtEt<$ÉEyf考))ЋU4$D$W MRt&'U]Éu։}<@tT<*t($Eu^1]u}]Í&{u҅u΋EEf{utׅvtȍD$[$xtP@tc*ux]ftlf눍ɍtEvDE16f*x]QvUWVS҉UME<$l U ƀ**PEtE썶 uӀx*e*Z=(|$4$Ѓ D$7;ut4$St&t ?v}}vB}Euc;}w^E t@]v;=(t$Ѓ D$U$I79vƃ;uv1[^_]ÍUztUz}*uu|*fvWUGE <$Et&z\vRE$t&OvkvEt&";}]93=(|$Ѓ D$E$5uƉEU 8;}vt&;]f=(\$Ѓ D$U$5u͋EU EXE U2[^_]Ðt&1V&'UWVS˃Ut8uO}Kvfv<$&$|$$x[^_]Ít&@EtGEt<$E댃tcuu9s댍9vx=(t$Ѓ D$E$a4t<$2Vt&9}s1v9uf =(t$Ѓ D$E$ 4t<$$ |$$s[^_]Ðt&9}st&9]3=(|$Ѓ D$E$3tĉ$\e9}]]t&9?3=(|$Ѓ D$E$"3tʼn$$&\$$[^_]fUWVS u ]~| t4؉ t2؉ t u 1[^_]Ít&A$g$] E [^_]| y`Bt$&UWVS,EU EEUtkM12U܅tE܀8u\EE1$@$M t^6;Eu݋UB$E,[^_]fExtUEztM܉ $dE{C$EE}EEESML$E܉<$D$}MA$ <$\$ƉD$EEKU9UtĀ}t}U몋A$$] E,[^_]K&UED$g $WÐt&USÃ&H$UWVS|E} ]EU :$@HEMt E8EtU t U :E@E^=E;Et$EE$3E|[^_]Ít&EMuM9y$7ƍD$eE}D\$U$ML$E$EvExUEzM $EEME|[^_]ÍvE@۸t ~uHE;EsED$U$E~4$M4$<t&릍E@EGfE D$D$E$X-ED$Et$$XEȃ#MEUMEU $蝻M9*u |*ta $NjE* MG*ËtMfuÃy**X=(Ѓ D$E<$D$-9}t<$諼>}f"}}1EUȋMщUMUE‹EU}ȋM9E]EEm;}=(Ѓ UD$ML$E$),uUMU ME E썶E$詻E$螻E$蓻tP]EE);E|"+EUT@UT$M $jE]|Euu vMu;utM 9荸BMEL$$MU :ED$UT$EE$MM]\$t$EE$辸]3fu[t&EE9E1UMT$ $iE$9EUD$$Fvy\9+v1E@E$D$uE\$U$׼p11f=(<Ѓ D$ED$U$)9]ȉs1fUE}ȅ]UẼm=( Ѓ M̉D$ED$U$L)uM̋U MĻE E(Ex$"$ƍD$FEMUȋ9EEML$E$v\$E$eUVS ueE1蹵)ġB\$tu=4$虹$t$$2ƋUe3\[^_]ft:tE܉\$D$$ REt$D$$QEăU܃MUȉM]ąېt&xU<xi=(Mȉ|$Ѓ D$ $&tҋE$諼E7E܉$ :v^U$pEMEM$̵E܉$4$ƍ@$Ht$EEÍEމD$ ED$$E$qL711ҍ&9}ĉ[=(MЃ D$EȍUЉT$$h%tËUЋM $葻EEЉ11fM̃9}ĉ U=(Ћ D$EȉM̉T$$$tỦ$%E}ą]Et&Mm l=(MЃ D$EȉUL$$t$tUEE$蠺E+t&UWVSÃ'UWVSEE4$.<D$[9E܉shf9vpEUt$$EЉ)UԍUT$ D$@vSu19w9wUe3EuH<[^_]9mэvEЋUԉEUf$E@迦t&'UWVS Et,Ǎ_34$4$赡G?Hu܋E [^_]É'UWVSUMEtTt&GMU qۉtcE4$D$"p?EuɅtDžt U$Rǃ}*tRE u:$É<$@[^_]Í$느t&뼍E t&t<$vsÐ릍<$pÍ뎍UW1VS<]eE1EE$ލEܡCt 8D$E؉ƍ<<vt < t&f菝EU\$$EЋE܉UԍUT$ )؉D$:@vlu1Ґ9wnE؋Ue3u?<[^_]Ðr$t&EЋUԉEU'UWVS,EeU1҉E褜)čD$EܡBt @t8uaE @E uq}tf_34$34$轞?uEU܉$T$Ue3uee[^_]Ðt&Bu&BU܈BE tE뮍D$ED$B$腠BUQt&'UWV1SLEeU1EEẺ$QEEȍv9uvo]̀<3\[vFEU]$EЋEȉUԍUT$ )D$\$@ҍ4:uw;}T9uȉuwŰEЋ]e3L[^_]D3<`t <\t <$d~&WvM1ҋ]̋Eȉ]Ečv]]Ĉ9MEЍwUԉEUS蛡&UWSEBX1B@ۉCuvtƀBuD$C$eΙvMC\$$ȟ£B@w7CD$ T$$BD$[_]Ðt&BCBBB[_]Ð BB맍t&'UWVS\EEUeU1҉MEEE8' EE0U2tu`U2uM̅t M̉ $Ut$M $D$`‹E0ЋUe3\[^_]Í&gU9 M\$ $J{4t&vNEU$EEUčUT$ )D$ED$ٙ@t 42vt&vU})UȉT$<$ÝLMȍE؉|$$L$T*]̅tME؋M̉D$ $还.EUĉEUlt&zwED$$D$Tt X$U\$T$Ẻ$"\xEE迖vJUuމ4$x<uAM\$D$E$QM>CM1E4뽐t&<'tSt&vNE܋Ut$$E)؉UU܉T$ D$@v5u#M4_&U4JE4EU\$ $EЋE)EE؉UԋU܉D$T$@U]Euf]Q t t u €Buʄtftb€BtV tQ tL tFU؍KMDt4MBt< t < t < t&uBufEE؋E؋ỦE"EЋUԃEEU t&UWVSAU1++EEEnE8Ue3l[^_]Í&EmEt #f\&Eȅt&E:E̅t U: EąU:`'t0"t&t&Wv>U]uT$ et&}UE}tUD:< t< t< $߂E]D$ Eu$)D$ED$苄@)<:Ejfv^EUT$ ]u$)D$ED$/@t!<:EfEEE]ufD$EUT$$$#UȋMUE؋E$D$ED$EUE؍xw&]uE[v]uECvExUEzE$EEzEExU$ąEExpUEz\E$茅EI$ËE؉D$EEU$T$)E[uEE]u <:f<'tt&Gv>E܋Ut$ \$EEU$)D$@vt<:ft&뎍EUE܉UtGE؋EU؃$E E؍xEĉT$D$E$Uč|JẺT$D$E$ˆU̍UE؋E$уD$ED$E1ۉ8r&'UEM UE EEZ ])'U\ U ED$D$ $] ÐUY U ED$D$ $Z ÐUWVSLEeU1EEE$3u &E|11vU9] '~:EuD$ E}$)؉D$E؉D$@1t&9] }&1Ue3L[^_]Í&\,'EEfuu$<;] &뎐t&<'tC}t&vFE܋Ut$$EEUčU܉T$ )؉D$~@txt&kv1vv"t&f|v?EU$EȋEU̍UT$ )؉D$E؉D$i~@vku_&vEUĉE܉Ut&}1u`UKEv@EȃỦEU,;&UWVSlEEeE1EEMU؉$芀U)؃1ۉUĉ$謿MEEE EMȍt&}}M̅EIEԅt‹U@rt&M\Eȃp{MEċU|$MM)UL$ D$$|E؃/E؅uEE1ҍ<t&9U؉uwE}}EUȋMEUe3*l[^_]Ít&\EЅtXM1`EЈEvUuEvt&EȀ"pt&`t&tV$vtnMȀ"q}{uu@EE0EUEU&E`EEuȋUU<(t<{3}ȋM}9(EU$gƋE$UMDCEEtM1<vTMuUˋEMEEȀ<t EȋE܅*4${EY UD$D$ $Z B&YuEOMuyt&UWVS\EUEEEeE1UU$|EE$|EE 11Es9] w&EUT$ u}$)؉D$E؉D$cy@1t&9] |juE4\%EU:'EEt&uuD<;] ~fEUe3E\[^_]Í1f<'tt&vvFE܋Ut$$EEUU܉T$ )؉D$fx@tXt&KvET$D$E؉$ +E]Et&v"&uv?EU$EEUčUT$ )؉D$E؉D$w@vWuKO&}1u8EUE܉Utt&UًEmEUĉEU|t&'UW1VS\E] UEEeE1EUE؉$y&EE̐Utmtt&E̍UT$ u}$)؉D$E؉D${v@U1uUe3&\[^_]Ít&\/Uȅ|`E'tEU$EẺUčUT$ )؉D$E؉D$u@v1vv`t&'&EEuu|<fUL(t {E]؀<9(E1ɍU$h]؋U<(v<'vfrvFE܋Ut$$EẺUU܉T$ )؉D$t@tt& v}1u"$D$E$$Vr&*EU$EẺUUT$ )؉D$E؉D$s@(EUEU&EEUE܉UtuEUEUzpv8MЍUT$ t$$L$7rÍ@EUEU< t < t UȈ:Euum>uM9UMMEu1*< t < t< vu-UuބMD$ $"u>E]EEEEEċU؋MD$T$ $&9E؉}M؋Et$L$$_É$fHỦT$$w@$EqME؃9EM|9uM}t }U܉UtNU\2MD$ $6!~Eu< t < t< fuf߃u}t }}ftMU }tUEu̅YM̋L $XE$EM̉L$$=EE̋EE}MU\u;'t&< t< &t < t&߃D$Eĉ$u CEEM }}t&UW1VSlEeU1EEE$pUƒUĉ$ʯe EEEu<'<\<"fwk EUt$$EEĉUUT$ )D$"mÍ@uU<;t$\$$ou]iUEUe3l[^_]ø+ẺE%t&E E txU'Ut&uU U @E\EsjUUf}1EE1jvEEȉ$n}Njuf]u\UȋEt$T$$Y;t%UD$$WoE$n<$E1lE&<'tt&ivFE܋U\$$E)UU܉T$ D$Ok@v!t 42Et&t&3vEUE܉Ut&EUEUQp'UWVS"<<~<'<\<"fGhEuD$ E܋}$)؉D$E؉D$i@teURv}tEtkE؉$l$իU؉T$$:mËUe3uL<[^_]ÍE9vu}fEԋU؉D$$^nt&E1ۋU؉D$$UЅt$p4$bmUEU ] UWVSt&wv}] E]; $@a ]EvE|;Eȅa}ąL|F4$5HD$$/@KBE̋EUU$h=&E"=&4t 4DBE̋MD$E $D$MËu߅E߉$`t&BE̋E|(Ut&4t 4DŰ4@EC4$ D$EĉD$ EȉD$ED$EyH=& =& 8t Ut@tE8$VDA]|~ AfDAu D߉C0B1ɉE̍ỦEED}Et;J $^E},vD@juȅ]|$63@}DQtHQfyDHS t DH V@tH@&UątHD$$r,vUE̋M$PUTML$ )ET$D$\,j , $蚞Dž,11fẼu;,Er,ET<$_‰ƋE+E9HfM |E))EU $T$a| 8&0&DA,Blj4$MҐt&U&`dEU$ŕDž,,X\Dž,]u$舕EWE]&ٱ$聓>PTDž,]u$!mLhlM]$\Dž,u,W$U$赔\$$VENjFX4$6LEmM $R|$R&,E&$R|$R ;~D$$Z$vR<$nREt&];ft?t&;v| $9R]$.R<$,JvuSE$D ЉD$ ]$Q|4$&Q}&0$E$X<>Tx+xD$@$DD$E$/pro@c/se@lf/ff@ d/@EЉT$D$ D$4$肷D$G$T&t;5&|j&M=&v &;5&~F&&D$&$軑&D$)ډT$&؉$|O&0&P Լ$]MPx,D$$}.@,Mۉ PxU$wLu5Լi.E$T@D$1D$ĝ $P$D$D$ $O$j<$1O4$S]$S1ې[^O A-p+EPc[$7-UxÉ\$$rPyaD$D$ $RO\$|$$$&WD$D$ĝ $O$9]t U$R|t$rM|4$R&0MD$D$e  $,$Vt&UWVS\U$ã&E؋EE&t$BG&ى]M؉E؋U؋B@U؋uЉE&E؅tKE؋tB5&#щڅtӉ‹B@uՋu5&Eأ&EgE؅}E>4$薥t3t $D5ËỦ$T$5MȅɉE}ȋ_EȋC%=tcU1ɍEET$1҉$<=&=&txEmG@`ٻ4$ETf$rD$G$ W_cZt&GU$\EẺ$QEAPE؉$-EU̅Ű$3E؋E؅t!Et U؉$UE؋]tq&tgMؾ7sB&CA$օuYvBuѡ&$tD&E؃\[^_]Í&GU$DDẺ$9DAՊ8 U؅%EEU؋UD${U؋B$hU؋B$pEƃE3E܉D$U$6UԉE܋$JJuԃ$ EE؋x:uT$$RuGUB뙐ẺE+t&AωxfAu=,t裉g莉Lv&&EE؃\[^_]ÍE$YIU؋EĉUĉEU܅Ut$E؋UE܉Utt&E؋U܉Eu܋Eąt Eĉ$GBE؅U؋$1E&9Ӎv}EETt&G$ËG$HGEE؉}؉}U$jEЅ}}ЋG@ Uu${tG$yE=JU]1$ Ht$$ƋCu܅E؉4$D$M0UEKt<$@}؅E؋0$/Et&֍$t& EG$襠ËG$JGGU'Bu'CE؉}؉}YGD$D$z $7G\$$轆}P諆tRCA$u=AuË5,tg뺐t&Uv&$?&EUE] UE] UE] USÃE D$E$C=&t=&t-[]Í&A~[]AސUWVS,E؋EMԃEt :k1EE>MtUU9t4$ EW}u 3$覌NjM tUt E $=}-t{}+tut&<$&F$(|$$GÉ$$lDU؉$]tYED$t$$蒿4$>DE8E,[^_]f11;E9.UD$t$$9륍&UEjzv$T0fE܅tEu:1vU$UEEuD$21IvUJ$U'UVS1ۃ 8t-udEEED$$É$輂$"ft!4$8tˉ]u]]bfUWVSÃ,Pp1tB@*tz{B<<$\ ȍH4`Bt u t t& uƉ,؉[^_]Ít&1{zv4$ED$4$AUET$$G{D;t&?&Xm1v<$l=CvȍH`Bt u  ufED$ED$4$t @11GEM@v*mE $D$ͫGs1 &uOME81xC1x2$>ؼt[$T$ZDžtD11?11<$1O>tt&11,؉[^_]É4$t@%$ >$>}\$$>$D$$m$;{4$e;$48b?&11vWUA-?ftԀf1y<$1C=h4$1:jA~Bg1B `Bt u tt&u$D$膡'y]1E܋X pD$T$U܉$腖E<$1裒D$D$B$Qn7vmv?&1v{&1 <$1;?t&rt1<$1;t&<$1趑EPUX@4$EE$&UWVSEU  e M1ɉX]ԉ]؀|#]ع $&MԋU9щHB9UۉTB:ELɅɉTtBEԋHDž8Dž@DžD#8yT-T?T#TtzT$ L$XEԋ<}H5t&Dž8Dž@DžDH#(!C< H1rDž<#@'HtEԋ|}H0< <D4H <B)Džn ) $1Ɖ$5<$- $l0< ~u1ҋ (4$q53{$u-H$??81ۅtt M1ۀ9ËTaT}T Uԋ$豥LEԀ<}Et&Dž<+HDž<x#?<@Dž<1*<&Hy tt Ht&$د$qfv5LыDPu _/]ع $UMԋU9щH/<-ttEt E8~ L$0H$0MÉx* ~ t&Hvvt&ҍ&|y!D$D$ɜ $!H\$$$!L4$~!&ELӃ&zv E Et;Ea 0聵EGÃEEUMD$ EȉT$L$@$ZUEt&DƋEUMD$ T$L$F$`ۉtuF$l~6uE``E EtES~$_Ëu4$^tE t f$s$$aÍvriv_pt(t8xDž`Džd1ҋly`dhll9d!l}uJ Z`dxx]$f!$`\$$!D$É$I$x:|$4$4$EUEЅw}}}hlM]d9] |`9uv`dEUX}A}'}fh}EEUOG?&7E&tEt <$ E11KE܋U$ E$U܉T$ )؉D$D$@v3t*f;hw֋ $E܉U뿋X A h\uT$\D$]lEȉt$L$\$ T$@$uh9a 1ۃ${Ɖ$tQu]+uOEMU$)؉M܉D$L$ D$@v+tft.t*wvދE܉UNjU\$<$T$, ËuuE̅t$ u(!1ސyEt&${xۉQhMẺ\$L$$끋ltdd`r1dZ``d`#dd1A`Bt u t uA1`d뚉4$D$}Ɖ$SZfD$H$.vD$O$[4$H$EOEfE~t9gf9E];t9NuH:*6 tw$}Y;}tM9E$}Dž`DždM]uMuttt:tzDž`Dždzt $kDžd`kftt Ev$f`vD$D$ɜ $HL$$aH$g $L$ 2$ X$Eoh9`HD$$.vD$D$D$ $(UT$$$XpDžd`}~1w uJ t)u$@W ljEw $W Wu$^ t UWVS}EEUU MxEE|eU1҉tE8Ewu0Bt> EUt$$EEUUT$ )؉D$ @oEUEUkvEE&4u<1ۃ} <$H\$Ɖ$P54$<$농t&<$`e<$xHލt&U(uu]u1ۉ؋u]]Í&>tE4$E $It$$b U 1&D$$EE襢&=&tJ=&tCEt$iCt^C`$dD&4$D$$US]$][] U(]u}u1ۉ؋u]}]Í&&t߉D$ED$$0tċ@8@tbut>.u~/tt4$X $H.@/@t$$ $9 k$?.tI<$ $;H|$$ 24$$Ht$$} D$/<$t.D$ D$|$$} /<$}mvUStW&tND$D$E$øt.Ct$%C$$1[]f1[]U&tD$$ U &tÍ$@&Ðt&Uu5}} ]&&D$D$E$&Ƌ@t]$^<$<$mF|$$V}ЃB?/tJEF]u}]fU$$FUT$$F$EFqt&v1U1UtB] U1ɉS]ti1u[]ÍU1ɉ1S]t&i1uU B![]Ðt&UWVS M} t?EPt5@~.1Uu 4t&t*$&ׅt&y [^_]&Í&E9pݍt&'US]$ ][] UWVS ]EHP~s1v  Mu'FvC$U C$$tE 3uՋC$ыEM E9xMA [^_]fUVS]$ Cۉt;$Cۉ^F~19|[^]Ð$@CF@Ft&U(uu ]}u1ۉ؋u]}]ÐFEtU11҈Ut-M1Ut&iǓ1DŽuF!EtEt&]t9{ uCU8uU$T$" uҋ}tUEFFU鐍t&UWVSE EEU1:Et.M1iƓ1ƄuU B!EU Uu 9t29s &uC8uU$T$Ru҃Ct&Evu1ۃ[^_]f$AUËE s CCE U@؉S[^_]ËU B 랍t&Uuu ]}EtpE11t$iÓ1ÄuF!؍<$AY AAE FA(&ED$t$$9o]ȋu}]$G'UWVSEE0UB$wMEAE&EUMEUUE<1i$ @Ɖ_$$?\$$Z_F1t E t;$U FG F G?FtBu$?E두$T$?\$$몍&EMUEEM9H UMBAE[^_]ÐUS&~0 &1f9@ @@@[] UVS&~T1ېt&&4$&@t$&2$9&&t$&&[^] USÃtED$&$nt*&@ @@@t[]á&Ű E܉AEA EȉQAt[]Ív'UWVS$ hEt%$]$=UT$$E=&1f9&&<U:t؋p ED$$~EċU&;u܍&&8@EED$U$ T$v&8PpUUT$$;uؐK&u8P@ D$U$*k$4$ C&U8pT$$f}t&;uԍ&؃t&D$D$ $sU$T$D$ 9&Ct&UD$E$ D$"U$Č[^_]Ít&UE  &9zEԉB9 CEBɉB BE;E_f؍&8P@ 9eu1ɅS9KCD$D$ $HEt&-&iv$ 4pČ[^_]Ðzv$ D$ CD$D$ $E}fvUWVS|U$UHD‹&]ut @u FPLttv1ۉ؋u]]f߉ $&$.LT$$Z@H FAF& AɉTPD1@D$D$$xP $!P$HFA F&AЃ &u[TT\@BD$D$ A A$UD$$ AML$.H$&f\D$D$$ AD$$ A &U՞ ]'US'Qt []ÍA CA[]f'UQt]Í] B{t&'U1҉'Qt Í& AD¡tރu١At@BD$$ A'US$AEF&QtE$[]Í F$$',\$$F FUE&D$$G&eAE1u*U t;}t}}t^@BU;vD$$ Af!D$D$ E$uE F$[]Ðt&FEލAU͐t&AE뾍&'U]]uu }uJ4$$*t$$W‰t ]u}]ÐAtBtFCvt>&uըuCPttc4$7v4$$$U*t$$u}‰؋]]$t&]u}]"&$D$4$$)t$$]‰u]}E ]]ED$$5CD$$",t&D$D$& $\$$]u}]ÉFD$$HM'UU&tD@u@&~>AvtvBvtV$vɐt&Í&1ɐt&Í&ҍuȍɐt&Í&+ɐt&Í&Cɐt&Í&ɐt& UWVS$0t& <$D$ u獝h 9t|$u\$|$$F`Fu~tS>uFtvtD$ \$$ 9uf(,[^_]Ív|$\$$b$dfU $@G$D$@GD$$(D$$@GdD$$lt-D$$ND$$:ߢ&v_UM=tl!tx-vt1]vÍ&Aftyfu0E%= ÐED$E $0E%=`ÐED$E $/ɅÍt&ED$E $/ME%=ÐED$E $/$;EÍED$E $^/E;EËE 8ED$E $D$E%=Ðt&ED$E $.},;EÍU(])u5)}<<$t^tt0C;))C)D<$D$,fS;))}'ED$$mu)1]u}]ÐD$h <$)))D<$D$}FUS ))‰tC<lt&n&2g&}fUE]u}]aED$U$b1҅f=HAu =(҃ =xЃ ЉD$UT$M $|(1҅P}1ɍvKvUM:$L$跿1҅&nt;oUE]u}]F}v1ύt&At&vv멍}v}vUM:ZED$U$1҅<U(u5)}=)]\<=<>tJ<\'f"&}t< t< u)]~ËUЋM\$T$ $ڧ}D$\<$Y!E?}u)E$.{p4$诫U܉$被L9ME)ES2fE9M~M}܉L$<$E܋EẺt$$ MttD< t< t)EtE)&M1\t8ufMT1P%]t&Et&跩MTDPuZ}u$Zt&86M;<\u名t&t& vEt&uE܉$4])L9M/uT22E9M~EU܉D$$E܋E܋MЉ\$L$$譥E8EUUׄu3})}u؋E1ۋ}؀<8rEdD$$'  Wu4$E܃<[^_]Ív'USE$1t"Z$$P\$$踩[]Í&'U )tE$Et @Ít&1ɐt& U)t Í&$ܣ)Ðt&UWVSE} E)t}U$tq@$<$E$v|$$ި^^F<$D t t[^_]Í؃F[^_]3$ ƋE$Χ$UT$$d<$誧$|$$CFF<$脧D t^ tYE)$d$UT$$\$D$$pE[^_]鼾t&F롐UWVS u}t,F F t$FX 9u [ 9^t|$$U y [^_]É'U0]]E uU}ۉEu1ɋ]ȋu}]Ës {uЉ} tߋ{O }9tҋA1ЉEE3 Eu&qE31 t I 9Mu럋y AEU3SGq~ }ԉu܋uЉ{{1} Us iE܋0xs{Vt&U U$]t$u |$u1$t$|$]ÐB B tzO 9u ڍt&I 9tωډ3Q3 uA US]t"Ct$][][]Ív'UVSutGFP 9u t&ڋZ $V9uRR FFF F[^]ÍvU8}}]uu1ۉ؋u]}]ÐG WEU tދU ~׋w1V 9։щUt&I 9t9E M9A;uԉq@ N E E؉U܍&]ԋU؋M܋C )K9ƉEuU)UMME؋])GMUWE_]O /E"t&UZ $Zۉ]uE]t`ËC 9uMC ]GGII G GuE E؉U.<$1 &UED$D$$?Í'U]]u}u؋u]}]ÍvSu 1㐍t&C C tr 9tϐF$]NjFt$P~v 9su US]t"$:C$][]f[]Ív'UWVSUEB B  REB U9‰EU 11$EE䐍t&MqtlE4$ϡUED9}{t$E$^E}t t4$8EU;P t)M L$E$)}E@ 9EEpMtU:E[^_]Í&9}\$M $Ehv$TEE[^_]Ív$@@2Ef4$ƍvU$]]uu }Uljp1t%E$蘠$UT$$.GGG ]u}]Ív'U8uu]M}UB Z ] uɋvu^ tSL$$D$S}B PWCX G  щG Wt_E@E;]t.E EU &ËUMKC ]9uCMPQAA v>1]u}]ÐUE D$D$E$Í&'US$M@@@ @D$$D$@ @C؃[]ÍUW1VSu 1҉ËE1;utVvFD$VT$$SRHB SMRPSBSP v 9uUuC ESUC؉S[^_]É'UWV1S }tlWƋGVWFG VF GX 9t?CD$ST$$VRB VRPVBVP [ 9_uƒ [^_]Ð&U8}}]]uu tdE4$\$D$;_|7~0GG WPw_J QA H1]u}]Ð;wwˋWB U9‰Eu vӐ@UE‹E11 tr;]}#vUG WBH A1JQ f;urِE@ 9EEtUE@UE܉‹E11 t;]|;ufsƍ떉 $vUB$}1t%E$E$vUT$$ۜUB1v'UWVSE t011fG\$t$D$ E$\?u؋E[^_]Ðt&U1S]t\$$[]É'UWVSLEeU1҅Eu!1Me3 L[^_]Ðt&@ A t$z(UNjBH M̹;EEt&M[EȋUĉD$$蘛EȅMȀ9uytUȸzE]D=Et5t$$?1>t~t~fEЋM̋UA ;Bt M MЅt4$E̋U@ 9BEM̍E1D$ D$QT$$ỦEȋBt $O3ƀ}Et }E t}E ftl>tf~t&t~&UE9ÉUzf9}<$\$_&11붍uЋMЃ9މ|)؃\<$\$MЉ)E <$2<$É萖x&Mډ $٘E fMȉ $4$贘4$觘v3vvUE]u}u1]u}]ÐUB J t$(UENjB1ҋp 9tD^1t$+$\\$$ĘMv EM9pup&UE]u}Eu1]u}]͋@ B tߋBx 9t1fWT$$W$=jt$$c$ E 9xuąttu]u}]}&'U}}]uu1ۉ؋u]}]ÐG G tGp 9t1ۍt&F$i\$$Ycv 9wu߅tt]u]}]|U]]u}u؋u]}]ÍvSu 1㐍t&C C tr 9tϐF$mNjFt$~v 9su U8U]u}u1ۉ؋u]}]ÐBtB B t߉$Nj@X 9tAt&ED$ ED$E D$C$ƋCt$Ss[ 9_uE tl<$E@ft@ 1҅t&tEUED$D$<$ É<$6D$D$g <$׉<$zf됍UHUE]]uu ҉}}EtJu1ۉ؋u]}]ÍvB B t9Z|ߍvA 9t&t;Xv98&EEE]܃EU[ 9ى]t;}}zM܉D$$L$] $4UtE EED$D$4$4$|9rt&f)]9]ؐt&Yfnv,;Xt&;0@ 9t&u֍$v?v| }fE܍&v1҅&tUUVS0] $mƍCD$E4$D$DD$4$'AÍED$$S$EU{4$sEt EU0[^]A\$0U(uu}} ]|$F$t6D$ D$m$D$u]}]]t&8 u5 D$ D$m$D$踍]u}]Í&UWV1S1ۃUEE RUtUZrt^'f\$t$ GD$E$ҋ?t9EPuыGU\$t$$D$ ?u΍&E[^_]Ðt&UWVSE UM$y$1$b\$$ʑUET$D$F$ $$\$$膑GFU MGGT$L$<$<$OFu?EU\$ D$FT$$7E U4$D$T$ËFtUM\$4$T$L$ Ѕt$ڍ[^_]Ít&$\GBUWVS,EE܀8(#E1D$= D$$ #t.ÍvCtt t[t7u<$)GÉ<$E9Et U܉$0,[^_]fD$=$=tC1$aD$ECMu(?t&u[tN]vtFt=uڃuC$蒌CU*\믋UE1ED$$Ev'U(]]}usftt$ D$D$$Ct$C{C Ct$ًCC@@C؋u]}]ÍUuu]] 4$tRu@ft.]u]Ít&P@t1t4$C1fE]u]&u]u] U(E U]uu}}E衬UUUD$4$tj@@tuL؋u]}]Ðt&t$EUM} uE}؋]]zf$0Ѝt&4$B몍4$Í몍UWVSE@[ЍCtC$\D$$TNjE8*u EE<$D$Ɖ<$~ot&ۍZCu6 t&Bs&5v4$1.>vD$T$C$<$É$$$c$=ǐ-ft&'UUEM U1]'UMEU M]U8}}ED$E]1ۉuD$<$FtNU<@tV<*tRE~PD$$~x@MD$T$4$L$M L$ <4$6؋u]}]Ívz]u4$1<$<ԍUVSuD$[4$3t4$F[u 1[^]Ít&D$$p<]u݃tؐt&~S &t vtv뫍v9~  t uӍv捴&'US] D$$:]tN$D$$D$U\$D$ U$J D$&[]ft@tI*tDD$$xQD$T$UB$31t$c1[]Ív{uU$1[]Ðt&$D$$D$菂\$$T D$E'UWVS$e@9u7u(t¡($u볉4$D$t&뗋EM1EIU]3u53}=|3UE$ |30 33 Q 耞U3]53u=|3}U] UWVS<9ʉEЋEỦMȉEu MЋEĉE<[^_] $EM9MEUċEEEEEfMЋU؍Uԉ$nsM؃9MȉEM|EЅE<7} 18t{vft8t&u uv9U}EUU9Uu܃}t M9M0}9uau+učF$t$MԉËE$D$^n3$> $p4$pr\\$E߉$Et$$u4$oU$9rMf{E$M܋U؋E$rD}4$r\\$U$螰Et$$SuM $qUf,4$goM9M~ ]M0EąE<[^_]f1Eȋ}9}|$E$E{@E9uUԋ]$Hq$y\$$qÉ$$n E$ qM}҃}TE<[^_]ËUЋfUWVS }<$$Et_$DnރuE 1[^_]U1}dHJp\ ,]Ít&U,dH]Í&UMu*f<&t4tt<\t&uu荶1]t&Í&I1]US؃[]U1҅tÉ'UE4]鰚U襅,uÍt&蛅ɍt& U8uu]}=0=@HE )贅$n ɉEE$nÉ4$nDE$t$ML$ËD$ D$D$D$$r賄W\$T$$$ lt54$Jf)`HpH4$hH]u}]<t&U8\t"M $n&胡EvM| \t1ۉUEfE$mUWVS\Htt U: t&=<E[&v0=(Ѓ D$E4$D$Uá8D8uVE U;<}T8@tD$ D$&$D$Suv1[^_]Í\HE U$E[^_]裂.t&tM:聂t&4$t&iv v$[t>{ftN(u1]u}]Í~|(uߍDD$)$Í|$uDD$}$u%둍&DD$]$tbofU$ ??Jp\ ÐUE u * *1҅u]Ít&*t*]U1]É'UWVS ]$ d$Qۉًu v'tk"tft,t%\t0t9u1uۍ& [^_]Ív9u [^_]Ív뚉Ǎ&UM<"t1<'tT$ $Ít&ЉT$ $ Í&US )t4*~ 1ۍvP*$`9**[]Ðt&UWVSw@U܉Eu vÍCuC$AELqUG*_uEEMUMރt3$U܅uڡLދMUMu͋ME5Lu8]t&uEt&$t_uU$e_}MQu7vEU$0_[^_]Ít&$_ÉȋMHulj}뵋MALu2U$^M $^[^_]Ít&$E$^Nj Ld$҅U${^@$f^UBG$O^Ub E1É'UVS=J#`JD$E$(D$0 É$f}$]tt4$[^]ÐU] E-1É'UStD$E$$ÍED$\$Q[u!$e]E%=@t[]É$D]t1[]Ð&UWVSӍ t t t ٍv&ٍPt  t ttj"&EttAËUtf11QtPu\t/9֐t&u [^_]Ít&"t1'ut&딍Qut&tD$D$p $o\|$t$$諽D$D$ $<\|$$|Y&UWVS,*u}1ҹE܉<$kxuD$E4$D$HEtt&:t[Pu:tHD$D$ $[t$$м,[^_]Ív,[^_]Ív1ɉS<$x݉D$E4$D$JH*T$ D$E$D$艫ED$e D$E$1됍vSK*'UVSP蓎,J91< u;\uޡ*U Dt]N;$4$\$賛t$$]D$D$ $$גP1[^]Ð:D$D$ $ Z$P[^]á*U tT%:P[^]É'US*]t$YY$[$\$$J\*// *1[]Ðt&UVSE ]uN)t$X$I[$z\$$[)$%[)+[&\ã)tX5)t# ):u׉t$T$ $[_uË$Z$] E[^]a[t&`1[^]Ív'UWVSE ]u])t$X$)`Z$葙\$$Z)$ZfUD$T$E$]u$hYt&}S1[^_] UWVS }<$0YTƅuDt& t7C9~~) :uމL$$^u΃ [^_]Í [^_]Ít&'UWVS,] $*t;4*t$7V4*t$&VE* *$s #1҉*,*$ ou Bn.U*$~E8~U$W$$UT$$X4* XJ4*ɉ$*6$W**(*t$7U4*$W$躖\$$"X **(*E$IW$zUT$$W4*ã$*$W**XJt `Je$_) **0*)t$[T))t$@T) *Ff#*1=,**&*,*D$4*$D$ZE܋E8~$U$.\$$VU܅҉*,*$W,*$=S*D$(*$^*,*4*$**,*D$4*$D$nXE܋E8~$UU$U(*Eԉ$T$"\$$U$T$\$$iUEt3tU$Сp3tU$ЅXJޅt)`JD$E$9$RE$Q4$NT4$)QU)ߍD$oƋE4$D$T=,*|$Uԍ$TU܅&4$QvE* *&*Š **t!4*:u͉L$T$$Xu$S$趒\$$T,[Ɖ^_]Í **\*E9[<t&;]؉*5XFtFt֋*҉Ut)4*:uET$ $D$KWuvC*$R(,*D$/$gO *p*4$D$4*D$VÅ4$JR${t$$Rơ*],*$O],*$O,*,[^_]f*4$D$4*D$Ui&$TOuT4*$ 61,[^_]Í&`J$D$2$*4*$N$*4*&U$E8~$t&vBt& **5)t&p*_ *B*t!4*:uƉL$T$$ Uu$~Pfv* *fD$$ 4*n5)f5*$ *B*t!4*:uƉL$T$$bTu$OfJvU*$O$UT$$MPD$$R$*$yO*t0* *<D$ *$ *u4$L$Of.<~u4$D$4$L<.t<(*t$qL4*D$4$D$t4$(*KL ~u)f밍&'Uuu]}<$<~sHt >@ Et,HE 9E>3a 4$1tiD$v 4$ktSptL=3 uC$1y7&}'t&t ~(fbD$ 4$jÅ؋u]}]Ð)D$@i 4$jLx@3tt:uT$4$Ru4$Cu$ u8~u$ e33Lt&D$/4$xuD$ 4$iV$t&<$ *3>~!4$u)[vD$`w 4$hiD$~ 4$Pi3`a vUVSE <*3t$vI*;*t t$]I*t$LIED$$eơ/4$K$賊t$$L**9ut4$H*$Sz18*=Jƒ!‰<*<*1t8*8*[^]f4$J$-t$$K4$*JÍ@$t$*$jK**DFvUVSu ]bt*t$Hx*<`P<$X13l*$KJ$|\$$Jt*|*t$G5t*4$J\9< < u9u5vX9t*< < utԋ5t*)l*uD$0 $f|*|*Jtp*31p*$Ax/&|*p*$Il*$1ál*tMD$x*$D$D|*p*D$l*$bI؃p*[^]Íx*뼍t&D$$ө 5t*9s1< < 1ۉ[^]Ív5t*D$@i 4$Be|*v{(D$@i $e|*Np*b|*WUWVS<D$xeU1҉$,DzD$<$t$C2DžtÍv   v &t#vtک  ljtr t] tX vt` vtX vtPt& t&t: vt2 vt*t u׍&ҍu&5$dEMe3 <[^_]ÍC< < < < < vu1;ȉD$D$ )ˉ\$$D@*Ƅ*Ѓ9؉wP*! t€u҃+A$t$${E*P*=, &  tz tu ftnҍt&#&ҍ tV< < < f< u͍qv&c.5) )ЍK )P* *L$$ *P*GEt&'U$ NtP*t)Ív$ $uָ ω'UWVSU  L*t$@UL*@*@D*c)@*]];iM $BE䡤*11E1E$P*M:;5*}8EuՋE;EFP*M;5*M|ȋEt!E)>1=L*H*L*u1ۃ[^_]ÍH*t$A$áD*L*H*D$@*$*B؃H*[^_]Ðt&)@*@*>*$ *1~P*1f9|UEEЃ))EU<$T$ET$ $D$1EK[U )u+P*Ít&USE ]`*t$=T*$X*T*<{T*$&@$W\$$@`*$@\*h*t$`*$۰d*h*h*u 1ۃ[]ád*t$?$~ T*ɉt X*tah*d*D$ $@=T*tC؃d*[]Ít&T*T*<{T*fC{f$?f}f뫍U*t)$9*$<**/1Ít&U30 |3p3 3 Ít&'U$PiXt Eh x1Ít&UWVS|E0D$$4$ED$t$$;`J4$D$4$;EEuo?.$ <$ÉD$$P;D$4$<4$=|/_<$;E4$;E|[^_]Í&4$T=$|t$$=D$D$lj$2ta$z‹EE:4$:<$:$3U:E|[^_]Ív<$T:4$L:${UED$`4$e4$lЃt P t uv@;@t&0D$t$$/ us@;@*t$7*1ۋ0&0<t!XD$ө \$$蝿9}ً0E$]D$ө D$y 0E< < \$ $D$ F\$D$0$A$U9UvEt$6Et 3t 3UD$] $VUu 3 vv1ۋED$`w $UzL@;@E <>&\$$0<`U:`sUD$$T$U0D$T$$-P t UD$$ rEUD$E܉$T$D$ ED$p*K&UWVS]Y<"<'EEE8~x}]}11}u$g;]t$4}<$6D$vEuu R\F;t>t4<\tD$3$"t\u<$3}<$T6ƍ@$u|$É$6} t_<$3[^_]Ðt&$fED$ $EEyf}tD3t&돍} t&z}]vt$D$^}_$jnt&t dHtEE ED$!$tEEU]]uu}*} t t;t]]} }uu][v:u܉T$4$Y:ủ4$4$s]u }uE];5&US$$ E_EEE$nt,8t'$O4$s\$$4$$1[]Ít&UWVS,/MuT$$E@EO' /4$3$s|$t$D$ D$D$É$8U]yt& $D$D$ËE죴@0EDJ@J$J/,[^_]SI0$$hH.I4$ 3$;rt$$3D& ,UEɋU uE( 1]E- 1]'UEU EL ]et&U=/ ]3u5|33|3` t($ |\5|3u3]]Í$?T\fU]|3u53$?|3v 3\|3]53u]fU]|3u53$*|3v 3[|3]53u]fU]|3u53$?|3@i 3x[|3]53u]fU]|3u53$?|3 3([|3]53u]fU]|3u53$?|3~ 3Z|3]53u]fU]|3u53$?|3 3Z|3]53u]fU3]|3u53}=p3E$?|30 3p336 ZU|3]53u=p3}3]Ít&'UWVS,} EE~5**=*U*pXE*T$<$D$3uЋ\$0/$an] E,[^_]/&5**[EUt&$vQEtwtqÉNj5**%t&߉B£*t7 *B9|ҍA 4$*D$**믍&U$+UBUY*D$ T D$D$*$(E䣐*$-*c,1[^_]á*$q***&'U=]u}u /=$`  B1|353|3v 3$zW|3]53u=}]Ít&'Uuu }}]@J;DJ}@0< t2< t.D< t< tD$E$*@J@J~ND$B$U@J@J\$D$0$ut$WtK$)*=&\&t.u ]Eu}]Zv/멍t&D$\<$XÉ4$D$D$؋u]}]Í&D$*<$뾍t&}]E =u}]t&U$p ]uX/|353|3@i 3$U|3]53u]Ív'U$Ж ]u.|353|3 3$0U|3]53u]Ív'U$0 ]u.|353|3~ 3$T|3]53u]Ív'U$ ]u8.|353|3 3$pT|3]53u]Ív'U$ ]u}-3|353=p3U|30 $3p336 SU|3]53u=p3}3]fU5$9x/$ D$-/$'肙M1fÍ&USE $D$vA?AuJ9}CdJ;J|d//@ *1[]ÐUdxJD$)Љ$I8*d/1ÐUD$]Éu5tH}tHD$$跽5tH9Ét]u}]Ít&$$($Ug|$$(ʐt&USÃ0$D$-DJD$ D$D$@J$@J$D$)$[]Ít&C2D$ D$ $ LJ&D$ D$ $kGvD$ $ lJ&D$ $ LJI&Up UuD$D$$ IÍt&D$^ $` [ ǐU1ɉ1ҋEuЋu‰]Í&'U1Ut t&u]Ðt&US]E tыu[]ÐUVSM u]xvt: tD[^]Í< t< uyD[^]Ít&UU EUE ]/t&'UWVS]}t E8QEE<$U\$념t&xt&uE $P\$lj$ ]IU E\$$S[^]Ã[^]'U@E]fU$E]o U(D$]u}$_]^t @uE11$}U$jujuRE$wÅt15t'u#*UD$ \$D$$v؋u]}]ÐS$E맋E$$=UT$$볍vU11$B,u =Ht,4$<tE11$4$Kt&'UE$ɃÐUUWVS1ۅtI/fJ 6 u@"t1Åtz rvʋ1Åu[^_]ÐUVSE$警,tHD$$HÉ$諴$1Htt4$1[^]É4$`:4$t&UWVSUD$ D$$@D$D$4$*ED$D$ <$SHÉ$=*Eu`|$D$$ lHUlppD$D$<$1[^_]Ív|$D$4$lH Ulpp~-} t'=*|$D$4$|ppMg1\[^_]ÐD$D$ج $H$輯?fUWVSeE1BZBz tGwU$u8-t~$ޭt&& $It&"t&tvtvv1ۋUe3Z e[^_]f$Э xt&t*D$D$ $Ɖ$~ ^FVFB4$XM1ۉ$$pv 9l$T$$:6ufjD$D$$ tt  GZ1ۉ$|Gv:ED$D$$z M|E $ *t&,t $ơ,t $t>P G t&:&* &@D$D$h4$#4$iÉ4$1t9D$D$$J@$B$T$ t& vt.~%D$D$$&9tG $7 vA D$$B9ED$$A*.&8&*D$D$$t&4$Wv/v3CJ4$&ot$ÉD$$g9~Out5$E$PE$t&ED$D$$d$E$.E$Su94$1`v9tkD$D$$itHc$e4$D$yf4$f*D$D$ $lHl$9u4$D$D$D$$fS1fC Ct&M9U *t&4$t& t&*D$D$$D$D$$D$4$`8Dž ztDž zD$T$$89  t$; t&fvT$$yv$KD$ $*D$NG& D$D$ÉD$F$F$4)čT$F$D$~ D$D$$iat&D$D$$ t&uvUT$t$$ D$4$D$=4$v t&tD$4$D$=8 )D$4$T$Ë f*D$D$ $@lHl$q9=D$4$谭$wD$$^QfC04$9t$ D$;D$4$T$ D$7$u$)$3v$ xvvv*D$D$$詼*D$D$$胼|Dž 1K$7=*D$D$ $.lHl$D$6? 2fD$D$ $Dž u$$l$ L4$0[E$E$$E%=D$4$D$ T$\$$uB0%=t0E%=t! UD$ T$t$4$躩u8$B4$8Cfۉ4$vvt&'U(]]uE }sE,8 { vC1 x$T$OƉǃ}m}vE$t&7|$$.vD$u]u}]'vK |i,tuSz BC$ơ,t uCx#\$$tE< tt< tp< &teʍt& < tV< t&tN< t&tFu܋]C ;uCSEUP1[^_]Éʍ&tEvUE] U1҉E]fUE] U$]uum$!r^C1]u]ÍUWVSEE$qE$mU2EZ}M1E1ۉUt$$=$n!\$$]M99uE ] CE[^_]Í&E[^_]lt&E4$$ t$$XUB@E[^_]Ë]11ɋwU$]uuel $p^C1 ]u] U$]uul$Dp^C1 ]u] U$]uuk‰1t$oCC10^]u]Ít&U]uu}$kk8@<$o^C1 ]u}]UWVS/1t&<UuF1$j]E썴&] UM1t$$$\$$SMM]E9]EUppB[^_]ËE@1[^_]$PjEEfUSÃ$ +T$ T$) T$4 Tt @[]ÍvUWVS,} eU1҉MD$D$$ bÅtu^ET$D$ D$4$B$ D$ct2t.H@Ue3,[^_]ÃHfu$) =tvPufvu$fOUD$$T$K`ED$ED$ $T$A$4 D$cXP$) WyfUWVS $۱D$$EG$蝆D$$轩ËE4$莱D$$螩UƉ~E 9~1 u$GD$$WE [^_]ÉAtΉ$ Ѝ&$t&N$D$$ËE4$аD$$Ɖd&Uuu ]]u:*t$3t?=J#`J$D$ң*u *]uE]&$$ \$$u*뺍v'UWVS,uOE~:] iU  ɉu"jv<& t&tt<\t&uރu荶U U1!MEȃEF$fNɉU1ۈU#t]U$|9^~c=( MЃ D$D$E$H}ttUҍvtMWW9^WE 9Et U$,[^_]ÍvME D$ D$&L$$EE EUUE Uuu]^t0t$t0$\&F]u]Ít&$iuЋ$*čt&UWVSÃ,ЃtШeoCE@$Ed[4$]EuEt 8EM1EA11E%UM8:E9p~YEuՋ]8U1ۋUt$$\$$R4$&vEx ]t M $Mt ]$jUB$tU|MD$$L$|҉t*9|t"|t$| $|]SC|D$T$$T||t |@ucUB @t@ U@ KƉD$|$'Z4$|yV$|Ĝ[^_]ËMA$V1ɉʉtp&< Y<\ڄ؉L$D$4$cOWEA9M BG< toلuW4$||$$IY<$|U< s<\T1| CB< t끍AD$<$qXWJ$Pt&9vMAf1v@eEE&UrPo$v;PpP$U@ D$|$T4$;1F CC$? >|\$$W$|4TD$D$L $gt$$G~袧9t&yt&$?$D$D$D$ D$D$R$]$EҿU$$SM $E^e 8ExtExt $E]Eۉ]u(svMA:EEMu֋UBU1ۋUt$<$m\$$M]M룉]1ҋM]YE$ξt<$U|T$ $ V]$|\REUt&듋E|$$D$0&'U(}}]]u<$tg$ۉt@E|$4$D$ED$ E D$h4$t3$]u}]Ð1t&D$/<$t$rt1t&뮐*1UtB]ÍU*Ut tHu fÍ&T$$<ɍvÍ&U*u 1Ðt&D$D$E$t܋@Ð&U$(.@@@ @@@@@ @$Í&UWVS }$(_ ƋGFGF1t$i$\$$_F 1t$>$o\$$_F1t$$D\$$_F1t$$\$$_F1t$$\$$V_ F1t$$\$$+_$F 1t$g$\$$F$ [^_] US]u{C t$Ct$Ct$Ct$Ct$tC t$eC$t$V][]It&[]Ív'U]W&US*tFED$T$$#1t'Ct$ C$$[]Í&'U*t$i*Í'U*tD$p $a U*t Í&$ ܽ*Ðt&Uuu }}]tw**D$<$D$Ë@t$s]u}]É<$$E|$$CǍt&D$D$p $ȿ|$$r\v vYUEt]D]Í&'U*u$ɿ**$豿+*Ðt&UE}} ]ut'|$$菼ƅt%]u}]Í<$,ۍt&kD$D$ $ã*̾\$|$$u롍U}}u]<$t]u}]ÐD$D$Ю $ã*\\$|$$u붐UV1S] D$Hy$> t)at፴&[^]Í&dIu^ufύ$vt-C$8u܋C$D*uٍ1[^]f31 U(]Ӊu}Nj@$RYtD$]$t$ D$m$D$ͺ4$ż$x]u}]Í&UWVS ,u1&D$Gk 4$t3ptC[^_]Í뾍dIEE )I :tCu4$}U1Eu.r4$EEtvUB0t<=t1ۃt<=uD$4$ qu~D$D$]$葻t$$EEEu1}[^_]Å3)v04$'Et&8DD$4$#1[^_]ÐUWVS< })m$]11%D$$/!/EEEED$]<$P(v'&$]"<[^_]$^`IUf뛍v `IMf냍v`I@Ep`IU_&P 5`IBf8`IE( ˀt& v =dI!Eۍ&r&J&"&&tE܅tM܉ $ut&M $7>$gED$1D$]^$蒸U$T$D$+EtNMt^LD$ T$D$w^$uUrt $ ӽM $I1t/Mt(E$kT4$1D$@t-Ut&fMD$ $D$ t& vG$ ?uE؅,E؉$f裗vv4$&{EUԉ$E$t&v$tt&v$\t&v$Dt&yv$|t&Qv$dt&+vvM $PZƍ育$D$D$^$5U܉\$T$$nD$D$~^$UT$$9_D$D$?^$ǵM$L$D$`DUf$#^T$D$D$#^$dUT$$:D$D$]$4t$$oU+u ,t+D$D$8_$ش$+Ðt&US1҅u[]ÍD$E$"~4+9|9w +1҃[]É1҉ +t&|wD$m_UB$!++o'US1҅u[]ÍD$E$M"~4+9|9w +1҃[]É1҉ +t&|wD$m_UB$q++oUE]u$YuH5dI1҅t%4$虬޻,E$EǨËE<$踯i 2$!t&vD$$(DEwۍvu>$Ppthi VtZ4$蹫[^_]Ív$tdt1ۉ4$芫[^_]Ít&$1r4$ 뜍E1ۉ4$M[^_]Í&}Ev떍$_ '$t&v4$ v땍U8$]]u}u]5D$_$t]Lt(Pt&t&{ ]u}]Ð1뺍t&믐${ȍ=dIH +tx ЅۉErC8-u x$_`t&CE؋E؉t4Et E؉$迯)&1ҍ{vEt&EtOE؉$׫D@$D$ËE؉$?wt?W$3螥$$.vD$E؉D$ y$_S6ECEEG&D$$E׋E؉D$"$譨<$蔨ED$E܉$^fu,E܀8$-f$ 5EEXD$D$_$j$ ~E؉$Y5eV$ܭ}&tfu+t$豭<$詧$Uk 4EED$D$_DU1]É'U]ÐUW1V1S]kD$_$tVpt1vt6Vvt&[^_]Ít&뮐릐v뛍dI1ۅEtą3{$$_9$_3t!$Ө$\$$lÉ\$$ D$D$$> @$Ɖ\$D$$=D$t$$_,,4$إ/oUËp$SK0FC@ C0\$$`$:$_1t&Ut$B$LutUB$1EߋEu1ۅ9$_B$k % $/bin@:/us@r/bi@ n:/u@sr/s@bin:@/sbif@nD$D$$_*US]t*\$D$$_*][]at&E_[]U +]ÍU +]ÐUu=+ t +]Í& +]Í& +] U1ɉVuS1fB<w\Ё~[^]Ått덴&'U\D$ P D$D$X$舠fUSEE )‰t[]ÍvM ][]'vUWVS\ǃx^E1XUEt&~T{98U7[‹E+EuڋE$D$迪uNjUJuEE[^_]Ívs몋Bu߃ E t׍t&؍&'UD$E$7Hu1f@t@ɍÍ&UED$$1҅HtPÐt&UED$$1҅HtPÐt&US+]t$蹡$$B\$$誤+[]Ít&'UVS tg+t$b+D$$4+t?+$荣$\$$& [^]Ív+u멐t&g$͝D$$ơ8D$ËEtE8uTED$D$_$Ut$\$D$T$ D$$1TUWVS E }Eu }`Bt$ `BG$`$\$$?`B ut`$<$M}tu'=+ t3 + [^_]Ít&1먍t& + [^_]Ð}t똃 +ʍ&'UE D$D$D$ E$82AÍ&'UAt&8t!D$ D$E`D$$H@D$keD$D$ $V$iÍvUED$$1҃t fÍ'UeRD$ D$D$ $؛tkAt&8t!D$ D$ D$$蠛E D$ ED$D$$譞$ D$踢f+D$ו D$D$ $>jt&UWVS,E$EࡘEUM EUMt& t#mmKLU<tE u׋M E wME܋Eu0vE܅]t~VM:tY69wtEtӋ^$,tRM:u׉T$L$$茣uËM؅t4t&E,[^_]Ðt&EL$$D$YuM؅uу}t&u.EEtvED$F$N?Učt&+tND$D$Q`$^UT$$EE,[^_]ËUUE,[^_]D$D$Q`$ML$$SE Et&USEu[]Í&@tL%B< vt+t̍~6-v?&t;1D$$롍딐ҍt%vuЍqv뺍$t&CPu&t&ovfX,D$ D$$U9m'USؖ$>D$D$h`$萚\$$[]Ív'UD$D$x`$RUT$$Í'US]t2D$D$`$ \$$J[]Ít&D$D$`$ؙE[]&US]t2D$D$`$蚙\$$[]Ít&D$D$`$hE[]&UD$D$`$2UT$$oÍ'Uuu]] t:tnD$D$`$ޘ\$t$$]u]Åt\D$D$`$褘u] ]E]t&D$D$d$pot&D$D$d$HUD$D$ $"UT$$_Í'UD$D$`$UT$$Í'UD$D$$`$袗UT$$Í'UWVS<]E}t&ED$C$l\UE|EUUE@$wẺm$땐C$E{t&=t&v`H=+`| -t&E &u̿`Ő} EEEM&ŰuD$`$T$ t$ZE}$ 耓E}AtuEЉ$ESU5,t}tS}@tg D$ ED$ $D$˒E}Au,t}uME!$ ӒE v`0X&`uݐ$ 舒Eu̿B -E$v'UD$D$`$BUT$$Í'UD$D$̃ $UT$$?Í'UD$D$a$“UT$$Í'UD$D$g $肓UT$$Í'UD$D$a$BUT$$Í'UD$D$'a$UT$$?Í'UD$D$|i $’UT$$Í'UEuD$D$W $y$($US$]C:-tE$?EpE<$EE Et<$ ED$D$<${ED$D$a6D$C<$D$v]XEf/$y$腊1$@trMY$$+\$$蓌D$\$U$MQp PP~ P$>EH UȉT$MD$D$<$L$ D$D$\a$8$|<$؈EEE1UD$$T$dƍtf$Cu4$Z$tF@D$BD$ D$Ra$D$$Ív~$UEu-D$D$a$$Ifɺt&U1҉E]UWVS<$+Eܡ,"EE$7}}uEEUB;{t{UT$|$ D$D$$Y%ƅtG]܅M~-&$D$蕍EE܉4$耆EU҉E$ D$P&EUB8E?-GEEwv]tt‰D$$bu֋Eh^…Et=e nE&2EEE…EuËU҉UB8t ?-0$,vUB0\v1+vt$D$i$EU҉E|t&$藅$蚌1҅tK$袇<[^_]EvE E$dE؅t$ D$Xo$諆&SEt&UWVS1ۃ @BItE-A-(+D$D$ A$`D$D$$$uD$D$$$O$f tO@tIP9&;D$D$f v1붋T$D$$D$D$$ A_E1ۉ$vA$XP~PD$$V,~$/v$\i D$ qD$D$$c$D$D$$=$t$cԝt&D$T$$EE1ED$D$$fD$$D$$(+xD$D$$$ US,} 0ҁt uEN؃[] UE] UE]uD$$/} ҃ 4$Ht؋u]]ÐUWVS,]$cȜD$$,+D$$G讝D$$蚝D$$膝D$$+rQD$$,PD$$ޛEt N,+4$_u-t ؃{E EuED$E$P@8ZE(D$$GztJE|t&J&CD$ t$D$$c*&Uu EED$ 舅$cښ|$$ 芚E$`D$w=E|$D$ D$D$$iEE${k<$3q$c藙@8$c輙(t ,+~E#E,[^_]ÃEt $ctE룍vEt $cUAAEt&=,+#A@8E8EP ExE@@E@@ E@@ E@@ x yE@X { ,tuC$uE,t u-UED$$fmEED$D$E܉$ ËE$oE܉$svvxvD$$dHD袦$D$җt&D$$&E$ht&E$P D$mYnt&Eavt.,[^_]Ít&E뫍&=`I뜾v뒍dI1ۉEl$YeElt $UD$ D$D$$E$Z,EEU]E$t+tUE;t U$Ml]U$5l{RUE1ۅt Ae{AUE\$T$$pE_U$,p#h$hD$D$c$kU\$~T$$U$hkEAu=u(5Hu$w$GMt E$w$Ou ܼwE$#TU$mE4<$ m$;|$$mh$SX$&pv[Ut&[UË$ jEU$Ut0+Bң0+u AtÍvD$$dÍv'UVS tH+PW t:W t2x t*~ L1Ґt& ty t39= Ft{4$#<A$fD$D$!d$@iD$D$$wf+PW +PW [^]ÍvuF냍t&UEt &D$D$:d$h$Ðt&US]t5 \dt6D$D$$e$h[]lt&VdÐUWVSӃ31҉Et f u`HЍ4EtuE8-‰E0< vrE$iExPt<fx6:uMD$L$E$2nuf[^_]Í[^_]ÐD$ D$$fE|6t+9~Ɛ뮍UJMAE0D!w UW1V1S\]۲EEX-EX-dIt'@1:-D$‰$+D$dd$諲tvev\[^_]Ít&$e끐EsvEcvvSv`IECvEԋdIUt MԀ9-<T}Efvp$ U܉B$g$\$$ShG4$g$ɦt$$1huGtME܉}ED$=U܋B$c[MMЋ]tEEЅtU$LE}U܉1tM܋A4%$f$ \$$ugÉEEЅ>E$f$ӥUT$$8g]Љt&D$ CD$C4$D$O4$cuЋM $c]fC3t$cCt$c$cuҡ|$ D$keD$$+aG;B$D$D$d.\É[^_]f}s|E؍M1ۅE؃4uu `HtUܸ+`HҍU܋BU؋M܉Eċ?@U؋EȋEċUD$D$}d$b$D$Ot&yO‰]ĉ]됉!$dD8 |$f\$ D$keD$$_f1t&/U9Učt&~MEUĉMȅ}E̋EuȅuuċE;u>((EM؅t@,M؍xD$dD$*D$ Ẻ$^D$keD$D$ Ủ$^EtEK;uF;u2fD$ D$D$ Ủ$5^1t&vv($KE$ D$AeU؍1UM̉ $aEԅEԉ$}bËE$pbD$蠡ËED$UԉT$D$ dD$D$$fD$D$d$$d,JE$P D$E$4D$D$$  E $$dmED$D$$dEE^s[$[]ۉD$D$d$ _t$\$$\Et$^;!&lvEċM‰M&D$D$ld$^$ܿEЅt]fC3t$#^Ct$^$ ^ufN؃Ečv1]0vE1*E$O`EEĉ]=,dudE$_$ËEt$D$t1]E\U(]tuƉ}׉$Y$D$b$YT$\$$a4$L;|Jؼ-D$D$De$\ST$$UUVSܼtWE$u3dI1 t$t1҉-u۾u㍴&[^]Í&$[^]Í&'UܼEt-$eu- dIu*ɉt&$dÍvt&‹uB8&u1Ҁx붐UUBD$ BD$ge$D$wX1 UUBD$ BD$oe$D$7X1 UWVS,5]A11EEED$e$Hdv&諺,[^_]Ít&$e뱐v릍`IE떍E뇍&Ett&D$D$e$Y$Ϻ,[^_]Ðt&dIU!SSې!E0Bt UBD$e$D$V$^EEUB$QEtUB\$D$oe$D$ [V멅Zt&Kv&t X,1ۅfAD$D$e$NX\$1$D$U)$e>] $Et>}t8D$/U$Ut!E$詽1ۅU1ۅu;f$;TD$U$.vT$U҉UtyU}B0t0E$kWuD$ D$E4$D$Q붉4$t&uEtl4$Pt4${$rWU1B$M@e thT$1ۉ$R4$k"4$Z4$:Yth$Zu24$ <$,V$e\e &뀡*D$ |$4$D$P<$U4$t&릐UWVSl]eE1ED$i$t2sEtߍt&cUe3l[^_]ËdI҉UUB$腵55XEUBE$qWۉE1Ef(EU\$D$$[t*=(\$Ѓ D$E$(?XD8\$D$ f$D$ ~RMtS5XUEЃ׉E(T($(G蕋=5X|> t8/tSD$D$$WuD$$ QD$$D$H$W5Xt&U5XЋ&EEE$S1vvEhD$D$g$#S$D$PUD$t^$I$mXnD$D$g$RUT$ T$$T$$肣D$D$0f$R$D$*P5\vE11E$ DP;5\G((XBD$" E̋BU͉$D$OEED$D$i$OMd! t€u҉˃+]"8$ D$$X"~{v/($ֆ`M$M7D$D$f$Qt$\$$R5X:u1-$ t&N1D$D$g=UUS$i1һt& uZ$itO$ojt&t$Nmh J9 []f $xh[]Ív1҃[]Í&'UWVS1ۃLuݛt&D$h4$av&[L[^_]Ít&$|h볍vt&릍t&떍 t&농t&sv`IˀE`@XP؋=dIv8t3t.D$D$Xh$O$E:@t&2&tft&tNpH)5`Hu*@ )01v t&tޡpHu `H*1Ft&D$E$0J$ D$TEt$M?UT$G$ZyGD$D$h$M\$$fjfv<$1v D$É$pH$MO&G8av1t&\lH5U.elH<$D$D$Řee=xH£lHuhH+E)УhHED$EЉ$uM9|9J9}h)ى $\ft$@i{dJ9$1sdhiffMv$gL89fvD$D$8h$KUЉ$D$覲tD$<$҉Éd1EtM܅u!9| 9ːt&tE)؉Í4$ 47%u؉EԋS4Uȍ}t&(Eԅt EԀ8U؋xL$T$*D$ \$D$Ih$BHu؃]ȅEȃEȡ(u($cn`U؋$jEtJ<$GD$$@+D$ EԉD$PU؀=@++@+!f@+??B+ˉ<$[11<$<$踗$ ;ۃUW1V1S,]8DžD$h$NtYht,rt>avt.諩,[^_]ÐDž뮍t&룐v똍dI?1fh$DhD$$M<$Dh|$D$$Lt)ED$C$z tM9U$]t8Lt.x*;}" tta$$"&۸h$D$G$>hT$D$$F4$U;L@XD$D$$HFD$$T$C61<[^_]ÐtvF$3D$T$$ExuPPlvJs&n&-&?&x\$<$M]6Dž4$D$5<[^_]f$蠨v6t&/F8?0uDžu6둍t&\$<$\6t&ED$$Yt ]9UtCFyvSS\6f@X1D$$D$A;t&tC&<$ӧ6Av1<$裧v$sUVS ]tqCu8-u >fCt$$Mtu  [^]Ív [^]ÀxuÀx-uۍt&uD$D$ $>$룐t&usUW1VS +~[E111ۃE.f+$|$$ 95+~Et͡+$Ív$i4ø} t$9Ét+$=$I|$$] [Ɖ^_]Ð$(|$$< $V= [^_]Ð&U(}}uu M] EE}t$}t11}t\]u}]Í&+ЉUӉ11 tąx9f|9ύt&w}ftfU)fu9+|+$$ ~UT$$n?Ov:t&U8U]u}E<-<+EED$$ntjE}uEԋU tm+‰E܋EӉ11 tox+9'&}UԍvuE)Љ…y,v1]u}]ÐEc]؅~19+|σt+ƒ}ؐu$ 렍9Mwvqt&'UtD$i$6Ít&$i脜ɍv UWVSL}EEEt&G-+E܍ED$U܉$G8+EuEEEġ+‰E؋EӉ11 x9&|f9Mčvv^Uܻ?NET+~1ې+$9;+|+1L[^_]Ð}]ċUuM)ى뛍vxHM@$8L1[^_]á+&EEE$By.E#ExD$ D$D$i$r5$j7u̅h+҉EU1]ȋuЃRf¡+D$ ++ED$i$D$4EU҉EU}tL¡+ ug D$ T$D$ $4릋+$l+$yEtLD$D$i$[4E+D$D$i$,4$v막$uېf9$ D$<1.+$+$mD$D$i$5D$D$i$5$7$w\$$h8EEv'UVS$ D$$$ \$$É$ $".[^]É'UWVSEF9 !} EU04~49F hDžwt3TTT$$M#$'(@ED$D$$AF9 Dž ET$$gEKOE$P D$NE<\:,G<t <t&E胅0Dž8DžhDžl@ML$$賎 y,kDžDžv,4E胅0Džf<$fltl)tq3$3+=ǡ++3tE<$_'<$Í@D$e,Dt-SvDžXE0Ds4vh4~ 8J=, t $( -(($xjLP*P$3PD$ $e@$LD$D$E$ct2$WD$\$4$$E$0dj$Qg ϰTVhT@`ID$D$i$w#\$$跄DžX`ID$D$j -8JD$$. &Ks I~?@xD$$T$(E%=zD$$,n*D$У $NWD$$ ,JhD $}$@D$ D$D$$)Z5Dž$8BG$j ‰EE؉D$$t}E| DDžD4$D$$!\Džhl=, $8Of)vE0DžX,H$D$D$j$!@\$T$$6$xjHt$=, (`eP$艌E$`DžX.@ $&|=, t&y8T` UBLH8u (< t < t&t< u <vuމU苕`2LUET$$L$LdEdƋd $1t{<${`f `'`A8<$t#E8W뢍&<$uˉ<$ފH$P_DžXd$wɉX$_.1҉@ƍ&DžL^h$$xjGFDžX$pvTDžX8t&sv=`A$6]1;VE$v`ËBڋe$+^`B$zt<$`ftfH $]+7&aD$$ E E$]DžX`UAcE$vD$$C ÉD$$fE$y`B$w`A$LED$E$T$ ‹E8u,UzED$$C D$ai1L$L$D$OE2DžDt&UD$$,UE$蟉@BAu+D$D$j$$ }D$$ AfUE8et t1]1=]f u1=]U,]Í&U1}-,t0D$D$7s$f  $f }1Ít&$f  $f |1ÍU1}-$m Б u$c 躑$c |1fD$D$ˠ $c l$c |1ÍU}-t+,fkhHu譵܍t&'U}-td=uE 8et+ ÍE 8vuu + D$j $cVҐE $D$]]tV + Ð&UWVS,]?eEED$ k$QetLft'vt&t.y,[^_]ÍE붍&E릍&E5dIE#1EtFEH,1t$e}$&#yM…EuQ}o$菏}tE$t6f1}}uZtP}lu8 D$D$4k$|$\$$y6E됍@ tD$D$#k$\$$x6EQ&$8yv$1t&D$[f$ EuKD$D$Rkl$؂6Et&$t&U$T$1tP}f{vEvD$D$Tl$$w^E$薍t&'UWVS<`eE1Ұt{uԻd1.t&C u$ЅKSt>t͉$tދt؋C$Sҍ|uƍt&G$VEС`uԻt1 t:>tD$EЃ$C$dUЍ:xuƅGUл$lkvt@BÃED$$lkD$ ‹@ɉBtuKt&UЉ$qEe3uN<[^_]ÐC$|CtB뭐t&14vt&'UWVS EE`tpUt1: tT:uD$E$uۍdupt)UU [^_]$u [^_]ËhUWVS `tnU t1:&tL8uD$E $uۍd u8ltUU T$U$1E $E [^_]ËE$D$1҃uU $΋h1}-1빉'UWVS}Eu\$$-$Tt$<$$uփ[^_]ÍUSEt []($lk,ttPfyރt&uԋX$O$S\$$t$F$[]t&UV1S$蚤`1Ʌ҉øtt&u43؃[^]Ív'UWVS,`u} d0t&C $ЃEtH9t>StqtE$9fuȍKuAltlT$ L$D$vk$Su,[^_]Ív-L$ D$D$k$]Nt&C.kvEt&DvUWVS,}G\D$X<$g\t*?u損t&p=hI?tU,[^_]Ðt&EG0<-EtBUۅ҉Ut -tR+tMD$<$-oEf,1[^_]ÍF<-E-t&Åtw?Bou}ېC-+D$E܉$uaߐt&EÅu?0t&U܉$T$ uEۈ]EEE$;{vot&v1}+$D$f|Í&t$f$2,l}$:$1&vn,1[^_]1~v?.?D$+$xD$+$vtEU(E}} ]uEEEtNE$oÅE !C {t@E]u}E]iE$m@X$R$N\$$ED$ED$$ ËFK% CN tK  ~$<$D$褌$ )؋u]}]Í&D$D$l$$b2bf븍FD$/$G$.g뀍F$t&$Ac "$G0$ $lt)pt&[[^_]Ít&븍v밍vۋ=dI"tQ1te?&tD$G$IuԋG$cńGE8,U<-u zMD$ $MEt-Ev16t&}EuM$L$7&?D$G$A}u$ t&w$Tm1ۍ&؃^Du1<tD$$I.tD$$0.[D$$ .5t&$( #vG$Na D$$ta$v+ED$$'Ezft&Bf5D$`$W-UEz4t&UWVS,E u  Ez1E `uME$Ut>E E t&jE Et&U$Z2Et&E U EEE Ut&E$%Å3E:,}t/]t&E t&"E BE $&EEE\UD$T$E$Hv r1U$1eE 3E &E Et&rE `%vU$V E E t&E Et&t&vU$-)E  E t&E t$vgv$W,[^_]ÐD$$@t&$;/&UҐt&}\$$D$nE $c$E,[^_]Ð\$ ED$n$D$}t&$lMɍv1[vE$E [E &E jE$t&U$GvxE xE t&E "UBfv\$D$$m$cx&$l`t&vD$D$m$U$T$D$!n$kt&v$)v$dt&1vD$D$n$\$ U$T$D$D$$q苓tgSt)pt&kB [^_]Í븍v밍v5dIF0< w3$c=to$$1땍v$Ӂ$\$F$¸SӁD$D$q$D$F$GW$Ɖ$t&quD$D$q$7t t$D$q$UWVS,E$IAt,[^_]ÍvdI(E(D$$H`u?t&%$t&GbBB< wED$$薤NM9U= $뛐FE죸(,[^_]Í<$fD$<$64$Nt$|$$Z$CxB;}JLt>D$t$$$&t&tB$-ED$D$$E죸(,[^_]Ív$FE(1E1ң(UEH-]D-É'U]Éu։$舠t4D$t$$c¸tB]u]Ív$XI]u]É'UX]]eE1u}tG*)D$$J)t==Ue3I]u}]Ít&=fҐt&E؉D$dI$4=EE؃d=E$hfUp1zUЋURU?:EE%UЉ$Z%EUX`BBEЉ|$4$D$f%UZE̋MȅtEģ D- A0EuED$D$$O a}?}C}fZ}Eȅt&E áED$$BrEލEމD$|a&E11ۅ`Bt  u퐍t&u1ۉ$mƋ`Bt  ut t&Bu4$#|$t$$#4$EWa4`Bt u$`Bi#|$D$`B$#E t&Egfffu&ȃ))ҍA0шu܉t&@-88@-D$$BrD$_ŰEEUލU?E`f $BrP$BrPE`f E`f Uȅ҉tU4GCCHHHB +H(xHH0HtHH-]Ív= -UЃ 1]Í1=U-1]Ð&U=t(1Ív$S(1U1ÐUSÃD$D$Ir$\$$9[]É'UWVS҉EEUEvUB`t҉Ets8lt1`tf tT8uD$E$uۍvMdthtt $ЋEEuE[^_]Ðt&EE Ut-ҹjrugrD$ L$D$mr$_Ðu$vT$ D$D$vk$6Ëvڐ&UWVSUEEEEU`tBۋEts8lt1`tf tT8uD$E$uۍvdtuEMt5U҉UuE[^_]ÍEEҍ&MEt&빋5`tt2׻dt s tuMs uEE[^_]Ð&UWVSEU EU`ttbUlt1:v tD8uD$E$uۍvdt}ɋEу1[^_]fE[^_]Ã}҃[^_1]v'UE]u$٪D$$1ɉƉ‹E 4$1؋u]]Ðt&UWltV1S $$f`tE1t=t&$ $=\$$ UuύU [^_]Ít&UWVS1ۃuD$zr4$tpov4[^_]Ít&$@t뾍vt&뱍t&롍t&둍t&끍ڋ5dIQ؃ tztFtA1-&6F$D$ uِt&aډ[^_]f1E7F-D$T$ D$k$6F$սuEu΅uɡvtvD$ FD$vk$D$뙐t&苻vMt91t&=D$D$t$$2؃1D$$Ͽu1\$$谿vF$V=ك؃[^_]i=`t؃E=ؾdtE荶Uҋu9Eu Uى~ u1EU(]É}ωEuUBtύU܉EMUE먡 $D$;;$;-t U;(-t --=<-=(-$0$3b-/v\$U@E\$ED$UT$ EԉD$Pu܋R$-}IPu܋1ۉU-ЋUEUm|$ESEEU\$ UԍuD$4$T$ $D$诸G$nVÍt&#m|$ED$U\$D$4$T$ 讼A\$t$EEԹ0lIEơ$ǾME \$UT$ t$uD$4$.]܉ 0-4-5-ʉEu܋EԺ0lEá$"UEED$UT$ \$D$4$艻VDUET$D$U $df''@$D$m\$D$|$ 4$;EUD$T$UT$E\$D$4$D$ o\$t$Uu܉T$ED$ UD$4$T$詺8D$D$x$@UԉT$$}=-{W\$ t$E\$ED$ EU\$D$D$ T$4$qED$UU}uE8"-@E8"U1ۉUM1+MЋE]Ѕt:UT$E$UЋEUЉ$ܸ%:+MЍ&뜉\$UT$Et$uD$4$D$ UT$ED$U\$D$4$T$ $0$8 -$-E\$D$4$D$ yFt$u܉\$ D$4$W$8-$賷<-8- -D$D$$-$=$-$ -$](- -$"M+M-1ۋ@EE$# -hE11EP-UtL-UT-P-]ÍU(D-;E]u}@-tF5P-t >vM :-u6JZ-tDt&H}D-P- ]u}]ÍzL-މP-T-&^MT-Љ $׈EP-UT$诳ۉ=~€}: ЃH- ?KU ?D$D$x$nM\$ D$L$D$$蚲D-P-ifED-y:P-t%8t D-@-P-}fD-;UtM @-BD-̋u:ME@- 8:T:U뚃D-/E D$D$x$WU\$ D$T$D$$胱|UdIX-\-`-]ÍvU1WVSM U9+҉Eh;\-`-\-X-dIEX-tC8-t.Et+t"\-dI[^_]ÍvwtԀ-]£\IC0E:E=hItr|$ $ʰtbP:;f#&EM`-|u`-X-`I[^_]M$ X-`-CB`-|u`-X-Åۿ?`I?dI[^_]fMD8tD`IX-`-[^_]Ít&`-ERX-t& t8:A0-t}t+t`IX-됀~t;E?$`-`IMTt"0< `IX-t&tzD$@$vtaX-B`IX-t&A0<-f\-dIR&E?$^`-`I`I X-P`IdIUWVS1ۃ,EUMEED$yE$TA5vt&{,[^_]Í$zM멐M@Mލ]܅ۍv$E뿍&MUf`{=`I71ۡ`{`{8uD$<$ȶu؋d{ EIMCD$yD$y$ÉD$ Ф$ȦFt2$CD$yD$y$ÉD$ 藤$菦Ft2$BD$yD$y$ÉD$ ^$VFt2$BD$qD$y$ÉD$ %$F$t2$ZBD$yD$y$ÉD$ $Ft D$ D$yD$y$轣F t D$ D$yD$y$薣<$莫1[^_]D$yD$y$hD$yD$y$CD$#yD$y$wD$,yD$y$bD$6yD$y$Ԣ@MD$>yD$y$询^5D$GyD$ky$臢 D$JyD$ky$b D$f D$ky$= D$MyD$ky$D$* D$ky$D$PyD$ky$ΡD$SyD$ky$詡@D$VyD$ky$脡fD$YyD$ky$_uD$jrD$ky$7@]D$grD$ky$ED$\yD$ky$0D$_yD$hy$ D$SD$hy$蝠@D$eD$hy$xD$oyD$hy$TD$lD$hy$/D$wyD$hy$ D$k D$hy$D$yD$hy$轟{D$yD$hy$蕟cD$4 D$hy$mKD$yD$hy$E 3D$yD$hy$t&UE]P@&'UWVS]EEMEUEED$E$|-x-t-p-l-h-d-=t}5dI~1ۅuvF>6tPF$;u݋FD$D$Pz$H\$$6ut&[^_]Í1ukMҍt&/1ۅut&v6t&tF$QuFD$D$Pz$蠟\$$뱐$  [^_]ftt&kd-NjEGEG1t$M$~\$$h-G 1t$$P\$$踡l-G1t$$"\$$芡p-G1t$à$\$$\x-G1t$蕠$\$$.|-G1t$g$\$$t-G 1t$9$j\$$ҠG$tD1ېt&|$F$u6uvs1ېv1ېUS]t;u謙[]Í&D$=$4uω$t1fэ&'US]t;uL[]Í&D$=$ԚuϋEt2E D$$D$"¸tBB1릉$u␍t&빍&'U]]u;u諘]u]fD$$_<=ủ$d$\$$T0T$D$$"t@B1]u] U(]]u};u1]u}]f$t@-t$]^1t$謝$\$$E-룋 t$8t@t@v|$_E0`t&:t'wBUuU<=uD+E\$4$D$胡uՉ'U]U~ Í&$耗Ðt&U~ Í&$P~ Ít&@鐐UED$ D$D$$;ÐUEU D$D$ D$ET$D$ E$EÐ&UEU D$D$ D$ET$D$ E$EÐ&USDU eE1ED$ ED$T$D$D$ $]E$g$\$$Ue3uD[]f觝vUSDU eE1ED$ ED$T$D$D$ $D$$\$$耛Ue3uD[]f'U$. .]Í&U1҉$.+ . t/؃D$ D$T$E$y Í& .$.fUWV1S }E |$D$E$0yu8uũ [^_]Ít&UWVS } uEt$|$$yƓ8&tփ [^_]ÍUS$.9 .] t1t-۸t .- .[]ÍvD$D$-E$M .~$.$.[]Ð @.UtU`.t }.u]f1]t& UUB BB B ࿉BljB1]Ív'UE` 1]fUUB"߃0B1]Í&UE` 1]fUS]$nxc 1҃[]Í&UE D$D$E$Í&'UST@.eE1uUe3uT[]`.]$Ed.Eh.Eġl.Eȡp.E̡t.EСx.Eԡ|.Eء.Eܡ.Eࡈ.E䡌.E衐.E졔.E.EY\$D$$ AUX@.eE1`.Ed.Eġh.Eȡl.E̡p.eEСt.Eԡx.Eء|.Eܡ.Eࡄ.E䡈.E行.E졐.E.E.EED$D$$IUe3uÍ&蟘t&'UX @.eE1`.h.Ed.0e߉Eġl.UȉE̡p.EСt.Eԡx.Eء|.Eܡ.Eࡄ.E䡈.E行.E졐.E.E.EED$D$$bUe3u迗t&'UX@.eE1`.Ed.Eġh.Eȡl.E̡p.e̗EСt.Eԡx.Eء|.Eܡ.Eࡄ.E䡈.E行.E졐.E.E.EED$D$$艘Ue3uÍ&ߖt&'UST @.eE1uUe3uT[]蜖`.]$Ed.Eh.Eġl.Eȡp.E̡t.EСx.Eԡ|.Eء.Eܡ.Eࡈ.E䡌.E衐.E졔.E.EY\$D$$艗AU@.u Í&D$`.D$$PD$.D$$4@.Ít&U]&U@.t Í&D$`.$ȏD$.$贏@.ÐUWVSL?uM xu>1D rT$E Uԉ$D$EtEЃL[^_]ú뻐E$jUԉED$D$ ED$E$D$菎EЋE$ P Uĉ$E$|$|9 EEȋ@EtUЅuxEtq111UD$T$E$*U{@)ЉD$UT$E$DU\$t$T$ Ẻ$9}sUȋEJ$ݎU$ҎEԉ$跋EЃL[^_]ÐUXEU ue5u1]}EUl$u tEIu;Efu^]tn1ҍt&>v|tEvEu~oxuxt\vE$fkEt뎐迈 vЃzixnxt&U8eE1ED$EUT$E$蓓xЋUe3u<ɍ&Í&Xtkvt1҃뾍t&1KUWVSL]$$\$E$VuD$/ 4$PSxM1 r1tE؍EED$ L$|$4$~]1tIC D$CD$C$yA[u$}aAE$ʇE$yL[^_]ÍvCS<$D$T$y&Ct7<$S[lt&뮍E$at&떍0$}@<$E$'3\t5$t&t$$.vD$@&"$J|$$.vD$@D$D$|$賉\$$@USEU ]@+B+ Cx[]Ív@BCAyC[]Ðt&UUM S]BA=?BC~ -@BC[]Í'UWVSEU Mxz?B~ @B1IM7+ 4 )J CɉE)¸i@B)mEM )E4q҉ЉUE})i@B)ǁmE E )¸J )ƒ}4JtVUC )¸Ci@B)щM )i@B)ׁj1ɿgfff&t ~)ƃu1t ډ[^_]ÍvUC E$]|$} t$07H)¸Mbi@B))i)~~ F$t$|$]Ð&U(ED$ED$E $QMED$}D$D$)kE߈뛍vS{/tt._K{/tI;uvqEЅ&Ff9us>/uʐ;;uU:/E,[^_]À/E1ME/DEE;ut/.F.u$蔄$\$$-E1My/nAEU$'EUWVSL ueE14$R$P4$$$Ut$$轃/2Dž19Ήr-f9w+NjDž)҉DžU/.;t/_t1/t,+=|ED$T$ $94$Ƅ訁D=D$D$$ÂƄ/$L$\$$/‹߄ $~8/uƒx/ut@룍t&$tMG]+u3:t&EEt\EEyE hE WE FE 5Et ;{t&f_a1EEMA%m}B<TP<E1Et]\E}E{ ɉMm`UDP=eEYU }AЃ0<w.}0!ƒ t&t |ЍA<v}EE EEt|u.t&XP]<DCt1B<v؍B<w PϐPƍB<w<Pe}t=}}u\ExPdM 뾉Ѓ=v1UE]U+u2y]M'UWVS}+} G$6M 1EËE4E 19E~9uM+M ME;u%Eޅt M[^_]Í&EL$$D$ D$D$$\[^_]ÐUWVSF^EE UDZ]E$_U E$_9EE|mu1;Et.E)9EKUDZt3b;EuҋED$U 4$T$auE[^_]Í1[^_]ÍaEPUHAEU ]u}e5u1ؾԾT$D$$YuԾG%=@t!}e3=]u}]fؾ$]=Ծ󥍵ؾ,D$ ЃD$ T$D$4$a|$t$$XG<%=@1ؾD$ ׃D$ D$t$<$va,D$|$$|X<%=@t$<$,D$ ރD$ D$a|$t$$X<%=@kt03d/,3`/ `/󥍕DžDžDžDžDžDžDž ܾؾD$D$ D$ t$D$<$`|$D$ D$ D$$_! t€u ҋܾ)$Y$Zx.t$Z=wƋt$<$e[,D$T$$VuLltX\ 9t9};-\:T$$[Ӄt  ȿĿԿ/Dž̿/󥋽ԾƱ5DžP3/3/ l;/;5//ԾUWVSu M]}tWF>vTD$D$$VST$D$E$QTMRE[^_]þ uEE\C 1҉ B0v"#BWv=Bv>_v1҉utt; t6gfff#))ȃ0C t&Et-C[^_]Éȃ0up&ȃ0uSfE-f t&t~vt&"ȃuȃ fB0;v XC0t& wA0xLt&gfff))A0шunt&{00vȺ)A0ш뙐UWVS,U]u }t_E>v[D$D$$SWT$D$E$QU:OE,[^_]Ðt&E EuEM|9G}}&؃0 uEt}}XXEtB} t6#gfffMmE))ȃ0G} Et-,G[^_]É؃0 ubۃE- t&} }\EEU?t&> Ѓ_EU$t$D$T$ É UM$t$T$L$ w #f=&wv뎍B0ve}G0 Xfw v^t&f$t$D$ D$ 0$t$D$ D$ XÉ ؉uC0v0t&WvUf(؃ uډ؃ ؍t&00v$t$D$ D$ D0$t$D$ D$ ÉU8uu eE1]]}/v hMw/$t$MËUe3un]u}]ÍEE$Qu9fӍED$ |$\$$N@v9t)u1널t&TUWVSueE1} pt&D$\$4$tt|D$\$<$yѸUe3u Ĝ[^_]SU(txsED$D$T$OuXUftOEftFD$‰$<ED$E$9U t EU Et EUÍ$WJmUW1VSEu EfE\$t$$IL~)Å~ލu~΋E)؉EE[^_]J8tEf0UD$` $.*D$ $2D$ $6D$` $:D$` $>ڞD$ $BƞD$` $F貞D$ $J螞[]fU (00 ;t D$$LU1u%,0$@$-\$$A[^]Ív'US/(J/ J/tЋ /u =[ tt/t /uR轰t /t*[]ᐍt&D$i$4 /uփ[]Ít& v멍/t/u$á J$D$9 J$I>$=a&US/]t$Y=tI$?$~\$$F@£/t2$4 /1[]Ít&/1κǍ&'UWVS\=/JE$OJt 0$,5$Jut&$Jt$átېt&$>D$ D$$p=FE؍E؉EȍEEEȍVEEfEdfEEEE]ЉUfEEEE EEEED$D$<$F:<$?\[^_]1퐐U1v0u%/]É'Ui`0]ÍvUEE E]ÍvUU EU|0]fUWVSDJ}CE0Et{t&@J9U~ju t; t69Ӊv+< t9Ӑ~@JA< u݉Ћu t$ t&u1[^_]Í&9É~f @JB< t< u˃9t&뾍UW}V50Stnt&@J҉~]< t\< t\ tv vtn< t&t>< t&t6@JBх£@Jx < t< u @Ju1[^_]Ít&ɉ @J~B< t< t먍Jɉ @JtD{'UWVSDJ} 0CEM&@J9EM t t@J9~M t& t{t\9Ðt&~S@J9É~@u t~ tyM t v t9ã@J~ Q u@JP1[^_]Í9ã@JuQ `ލ9ˉ @J~B< t< t]t&ȍxt&'UU 1|0]ÍUE ]|01Í&UU[t(~.{t}t&t]t1t&]Í(t)t1t&'U /@%/`t"aw*0t@J1Ðt&@>@ ]Ít&]rfU]@>4SvU /@>%/Pw@J01Í&Í/Ut1D>@> ]Ít&]념t&U]@>4cvUL0P0tL01Ð#& L0D u=ǀ ǀ @l` @T` u= u@D 뎐t&UE E]*'UWVS }~`P01ۅusv9~I5P0t_5@Jt-P095@JuыE $D${%9& P0u H0u 1[^_]fِ&v1H0 [^_] USH0]t%~E $D$Z?P01[]Ít&H0ʍ&U]u։}ǃ /@ %/x$31v ?t؋u]}]f萉$t$|$8 Ӎt&USÃbtX0$0u[]UuƉ]@J;DJ| ]u]Ív0t ?t@J]u]Ít&@Jt$$z$;@JuDJ@J롍US] o|01[]Í'U@Jt;DJt 1Ðt&/v ?t -@Jۍt&@JD$D$0$@J벍t&'Ui/v ?t-@JÍD$@JD$0$芅@JÍvUWVS=@J0u 8$EAE؉Et&9Eƅt>.t ?t;_;DJ}`0$;Euu‰@J1[^_]Ív0D$ D$|$$W;DJ|t&S[^_]ÍE؉E9Eƅt.t ?t#_x0$;EuĐ0D$|$$19)f-vz?uqt&@J0$Eult$$!;@Juʉ=@Jgt&DJ9}ډt$$\!@J0$5EtƋu~UE ;,tqTF&u1 1f0uC/E$ 1@> D>P1Ív 1أ1t0D0d0@0D$ D$d01D$E$8ÍftStj1 1Q1 17& 1m1 1D$$d0¸t0%UD$$d0vt0~8D$ U1D$d0@>4D$$2‰ÍUSE $D$6 @JDJ9}0< t&< t 1[]Ít&9ى @J}B< u捶UE]US] $\$|01[]Ít&UVS]u DJ,*v ?tJ@JDJ90D$@J$@J~;DJt>1[^]Ðt&̍t&@JD$ \$D$0$讁뚍t&t$$1[^]Í&ۉ][^] 눍U]]uu }=@J~/)v ?t|)v ?tA)@J@Jx"|$@J$1]u}]f@Jҍt&D$@JD$0$ @J렍vt$$fۋu]}]]*f 녍UWVSà Mt&u=|$$xS 1[^_]Ð|$$/tɋ@J;DJ}|$$@J9~@J'v ?uE$c'멐 [^_]ÍvU(eE10uf/u=E£x0Ҹx EMUe3u8Í&U$f@>@ D>1ˋx0EU@.U(]]eE1؉uugx0x!‹@>4:‰ЋUe3u ]u]-t&'UWVS UA=DJ5@JGE;u$U0UM t t @J9~gE tz tu)A_F9ƣ@J})]Au_t t t&uύUFƣ@Jt|9E~wmY9@J}SX t t7)AlF9ƣ@J}]Au_t뇍&֍s 1[^_]f UWVS E50EM@J< t < tD< y< &jy(T8Gu1ɀ_G_t C@JÅۉ~~  &Guw_t&tnKɉ @Jx9TGu+_t& t! tˍKɉ @Jy΍&@JmM 1[^_]À_uۉӐS҉@JxLGuِɉ @J~P t t;vɍ_&fvC@JUWVSDJEE0EEE]@J9]&u8G_ tf t&t]9]v~UEK @JTGt)7 t,9M~' @JVG_t uϋ@JU< t]< tY&m]91[^_]Í&C@JËEGu_u9]܋U< u9]~ @JB< t< u9Mv놉ˍt&bvUuu]] xBy%DXu\$4$ 1]u]Ít&\$4$]1u]s΍Uuu]] xjDJ;@J~*$DXu4\$4$]1u]Ít& ]1u]Í&\$4$]1u]ދ]uu] 'Uuu]] xb@Jt)`$DXu3\$4$w]1u]Ívs]1u]Í&\$4$]1u]ދ]uu]t&U1Uu Í&T$$ ɅÍ'U/u0itxat;IuX0t 8$D$0Í&X0tӀ8tθaEX@J.10ÐX0t8tE*@J~10ÍD$I$ fUWVS@J /@} %/au ;u&[^_]ÍvD$$ FЃ w /5/4uw:5Íx8u x@ wڀBЃ F /(DBУ/p4tt&/%@/"%/FDJ05`0 CDJ0D4$D$0DJDJ9@JE~@J= 0 t/ t*D< t< ftD$E$@J*tf=tq\t\$$F1[]Ít&$ B|01[]f$*TBf$?DB1[]ÍUE /t?t51ɐt&Í&%D$/E$1Ít&s%D$?E$1ÍUE Nt"nuD$nE$: 1ÍD$NE$M 1É'U/t)L-+E~/U $T$&1Ít&D$E$'1ÐD$$'1Ð&U/uD$$$ 1ÐD$E$1Í&'U]w&UWVSLeE1@J;DJ|1Ue3nL[^_]Ðt&Ov?}Eht&WӋEEU$T$@J9~@JE$D$ M5@J;5DJ;y02Pat4ӋEE\D$$댍vE$D$mq@J}EE|$D$0$-du)}v$DEЋEЅD$E׋@J|$$]xD;D$$W@J9~@JU׉$K@JDJ9)0|$ D$T$UЉ$(]Љ$9$&t$EЋEЅ&D$$$n.US1 1B9|'A@1D$HJ$*R1HJ$HJRUHJ1 1U Q[]ÍUS1uA1ۅt%t&ċ$D$:u1LJ[]É'UW1VSHJ1tl11E1E(t&2 ɉ7E4]Dt,;]|ԃEE<$D$PHJ봍t&؉D$<$D$ x D$ [^_]UVSutC1 t&<u D$t<u݋D$u[^]Í&U$P1ҍt&Du U D u@L ǀ @D D uÍt&'US]Q1҉t&ӈыDDu[]ÐU&@J 1҉,101tB819}B41^@JD$0$D$H @J41D.B81D$41$N41랐&U҉]ӉuƉ}y؋u]}]Ív+&$E0&tՁ />^t1|$4$A^Á%/t%ËE$%뚍F|$$]ʉ'UDJD$T$$$Rt!|?t$|?Ít&vՍ&'UWVS U1:t_ 1tjUM4101tO01$á01$$1%$$ 1u뢐\$$0uut&t.t&,1@JDJ<\EFuHED$3$t8}'G@J}"Mvt&508>Q][0|$D$ D$$?9}Q}U9@J50@J<3MU|$$|$$@J)U}3t|$$uB@J9&M]E_E|$$Rw1ۋ}tUEu tE E,[^_]Í&UE@J_wH@JXۉ@J50D$E$u=t&v?u@JD$D$0$F<f3S}H\$4$Ѕuv-vD$4$҅t&f=vEEvMt&v1X3UfM&UWVS|EeE1UM~MEEMv ?i\J|1ENtvMA8EËEDXtRfv ?9u5MU BM8DAtӋ4uv9}~}EME9M4EEU:($(=\J‹E53t"3tXJt ?EED$ x D$D$E$}܉5@Jt$<$艍1ED$ED$E؉$Et$D$d$TE3Eg}*Mt&} }!ED$D$D$ $zqEt E$%/,[^_]C]t E$41%/,[^_]ÍvED$E$=@JE}?}@BE;txE$ɃEHa}!}@@腱Et&]Ut@J{D$E܉$YEܣ@JCsvMÉ$$g ;t$eu!Et&EE$%Et,ED$0$4E$%/1,[^_]Í0:T8)lj}&E0 t&sfMU4$:EUMƉ$$g ;34$at&vUE*]UE?]PJUu<=/p tH`3u/d3uE ]E@]v]rfE!]sv4uE?]ZUMx"AvM hJH1ɉ]át١u߀1BU Pʼn'USEE D$E$i[]Í'UED$$7Ðt&U E D$D$E$Í&'U1҉ESM 1 t'<u9DvuDuى[]É'UWVSU u 1ۉM1+&<uK|t|R˄t\y؋}tэurW<tt&|u!MtMB[^_]Í&1[^_]Í]t׋M̍$ut‹UG뻉'UMt(1ҁut&9 tu1]Ðt&UEt] U]ÍUtu ]Ív]Ít&4$JY,[^_]f9UƋD;ËEtZۺtڋM丝tED$ /T$t$D$-D$$s4$$fۺtڋM丝tED$ /T$t$D$;D$$뤍vC$MɉtU$T$a\DeDv'U1ɉE] UJt%/D$D$$Е D$ /$j31ÍUX4u(D$ D$gD$$3Ðt&D$d4D$\4D$LD$D$ $ÍvU h4t?~'D41:u&<t9t&=001Ít&ؓ61fUh4t Bh4D4D01Ðt&u1fUVSCt@t2t&D$ /D$keD$$CuՉ4$a[^]ÍUW1V1S\U EE<t8f<tuM E9DPtU <uʋU Dt׋MD$ $Et"@EEĉ@EE}1MσဈMEEE}f\E"f:UCM$D$#U$FEM9MEԋUMDGMMT9]lj$_$tiXt&T\C-?@cv_;]؉EMԃE܁Eԃ\[^_]Ë tU f\eCE ED$Eԉ$OE&\ECCt&wMċEUtaUȅҋEЋEUЋD$D$ D$D$$sJf}E$蜼vMȋEtoM랐\M-t&OMUBQ&/MQE E؋UD$$!E_'UD$E$Ít&UWVS E }E`tml1t& tTD$<$du]vU҉EtD]uD$ /|$D$ސD$$މ$;uƋu4$'ExEg[^_]Í&E/|$ D$D$$xEt11ɍ&ut^tthD$/T$ D$w^D$$,Eًt~t2U7]f$\Cu두ҍtT/D$D$$D$ 5띍&/|$ D$D$$苳uk/|$ D$̐D$$[fU Jt%/D$D$$Е D$ 蟹/$ (1Ðt&USE] $ 11Ʌu9t-<u;DfuDuٍ[]U1ɉW1VSEE…u*fM؉u M؋E{T…tm\u؋U_ډU хtSCEME}u}tu|-Avt&S1ɍ֍R< t< t2T fׄk< t< \t&ލ<;f< < < Bft < t< uvt< t< t`tbl tLD$<$Gu4$ۨD9r&  xPt9rt$<$W1"m$Q1EЍG4EхID;1t&1Eх#u\tC;UЍvu؅ҍt&0EM܍4 9t&(S1f…u%v1Ƀ;…tu\t)"t&u҉}ؐq=`빋uȍt&?Mȉ $TUEtMȍT:uD$EȃD$E$1x$1$8K1u#8t&\t"t)LLrtrt݅L݉7U't+"t&Mȉ $<$D$<$1Mȉ $ltUȍD:u<$D$EȃD$뷡UED$ D$ ED$$l1p蔣ы<:A+U܍4t&'UWVSÃ|U`4\4$EED$E$D$y荟ËE$|[^_]D$D$E$[xËUċuus<$ܦ7뢉$QEt$D$<$"<$訦9}E$}E Eu9@49t0t$V$认$\$$G@4]X4d49swv9; S1f< t 9׉ut&< tT< tPt<#t&t $v\3d49rE$蕡1X4|[^_]Ðt&u뾉1눍vϝÐGE$L距%U1=0]u}t]u}]ÐED$ =\45d4`4$tESq=\45d4`4맍'UMt39u1Ҹo2zt1҉&Í @4u$g:1tfU$tu ÍvÍt&USE] t \$$BE\$$蓎1[]Ít&'USÃD$${u+t%t[]Í&D$` $ t,D$<$$uv [^_]v1҃ [^_]Ít&UWVS`}`I&CYuMl/T$ L$D$đD$$tS tFuCY0uMl/T$ L$D$ϑD$$.S ut~5&D$/\$ D$đD$$ tBctt&uD$/\$ D$ϑD$$襙 u[^_]UJt%/D$D$$Е D$ /$J1ÐUS]Ct$苛Ct$|Ct$m][]`UVSÃxtP,@D$0$:x4t$CS0x4C C|4C,9|W)D$$蝫C`xW@J $D$1%/t4[^]f)D$$薬C`yC0;C,uC$C`C(;1 uC1$S҉C~1҉t&;S|<|?S:C,CC<C$:C CEC@0CX$ՐSt4C\@JC`C /u4t&$8CD$D$ ‰[^_]t& 1[^_]Íp4Kt&10$+$\0CT$$軐SC:'UEU ]UEU ]4Ut44444t @1x5]Ðt&U4u&8ut&s`51fUX/t41`5]Ít&␡d5Ud55h5]h55t5t55l5l55555p5p55555555Ít&'4;/Ut(4+J1~=J]Í4+J+/Ѝt&UJt!D$` D$$Í&zlv'UVSJut$D$` D$$討[^]Ðt&tv~"1ۍt&/$ D$954[^] UJt"D$` D$$-4$CJt"D$` D$$4/$É'U4}}]u9t^;=JV)ƅ~]1ۍv/$ D$ 9䡨JD$` D$$k4=4]u}]fJt8tt1ۍt& JD$` D$$ 9|fU/u Í&4$ /4$D$$耈Í&'U]u}|/tmD$ $&tTx<$GÍ@$vۉu(ED5]}5u]É|$$谋ʀ;u-$#1҉ƸM 멐t&$ĊÍ@$1҅ۉƸt̡/4$D$IڍC봍&'UVSu4$Mi~a1ۍ&/$ D$94$i41ɍt&49΍B4D4[^]É4$h荴&'Ud5t$}h5t$l55d555h555l555t555555p5555555ÍU4/ң4t41Í'USExP< td~t&u []t&Í&y蝇ӋDP@tϸ[]f 0tfE +E []ÍUVS]Cw50-yaڡ/$D$貌/$e[^]Ãuҡ/D$D$$D$ 菉?륍t& t/D$D$$D$ W蒆ڃ@DP] ڃ@ҋFt&/D$D$$!D$ &'UWVS 49~N9ǣ~=D$4$4D$4$k49}&541ҋ 4f:9=4tF [^_]Ít&9=}=$4$444$V44$A44$,444PUWVS4Y/$6y4[]Ðt&44<uA4$t44 D);Ju˃4$4\$'$/D$JD$~=t&'UVS/$zd5=4\$$z4\$$z/D$ $vtÉ$ytv?541ۉ=J4tZ4 4114؃9}4/x541[^]Í&D$$ tXf1҉%4Lv4p1 4돍/'UWVSEUeE1|sv ?>=44#x5);J-rsv? MEY _ M:T MuM & M:E9EE؋E+UEUuЉEċE 9E U: ӋE;t 9E ];uLrt&v ?UЋM̃9։UMs 9MR}]!&4;J/|;4rf ?Y 4|~$EEqM؍UԉL$ $D$ED$sƍ@/$ D$zE448UMf] E9u9ۉً}u]]+E9EuĉE t&EĄ҉Eu' t&?t#9EfM}Љ+EMEU}Љ+MUMfuË}9ۉldUЋMD$+EU $D$UD$E$EẺE+ED$E;uEs 9Em}qM E9MUtEExEEUE҉ M9u E11ۉE f>' tMx|$T$UL$ D$\$$IlM\$D$ D$ $r|$D$ D$ËE$QuUމ‰+M9MUMa+EUE7&UME}]:f< mm!E;uE]ȉ}}||5|!9 4E $nt ?|x5l5 /J9p549]|}$nt&_ ?R 5;4~PJD$` D$$sd5\$$Rmv ? 4t&UM4T$ $0mv.?u%4;5u4M+MUĉ+EMCmv ?ߋ|u5/uU;x5nu+umv?7u419||1;E…?tE9~ pJt tlthEt$$PU4Me3 Ĝ[^_]ËM)MȋMȋUEaUNjE)EMN) &E8/t 4 lt 5?t)9t%|$\$ D$D$$kpJs|$D$$TsD$` D$$qU\$$OE=4)؅]D$$O1҉)}Mh4t&E9EcUM:3ERUED$D$$D$ D$D$MUMȉUM9MEMȉE9jv ?UMUȉM|l5EUD$$t&E9Et&JEىM9/t4ux5t\tXE;JMJt 8:t6ut&t+]vJD$` D$$ou݋] EUD$$Miv ?#E4~YUt$$MM 4Kiv7?u.|u$|5tU;5)44uЋ]+u+]hv=?ޅ[ :4$@MM̉M̋UE+MEhf9 ?+x5+Ec4Et,UM:LEL$$D$q1UUuuUhv ?E+E1M1)M̋M̉ƋE)MEEtxxBtAEU+E+UL$MEUD$xT$UL$ D$$wM1U9 $D$!EED$腽MD$EL$EE$eE;uE9E5t& MuEMEuЉ+UEUMt$ $JE1|4ң4|5M; 5)У44x5+]9;p5'E)fft ?t?E8u7~3U\$$IJkuUEEUUMt$ $J|E4ң4&%l1ҍt&E9|~$1ۍ/$ D$n954tJt 8 Jt8uLM\$ $pI|J8D$` D$$jdt&JD$` D$$ju땅fJf[5vEtN/D$‰$mU44:MM/$ D$mD$` D$$jU$T$T$kMD$` L$$i=E)EUD$ D$$T$ûEEU)UMD$ D$$L$蓻EEȋEEEԉ$kmu~"1ۡ/MD$$l;]|4=4EE(cMU؉T$ L$D$Eԉ$d}@]Ӊ$gD$E\$$jUMt$T$ $bg6E-d514+|54UuEU1N]$ghUuЉ+MUMI'UWVS|eE1/|444 =044] 1E454:!4;5/td5h5t `59l5~0D;d5T$D$E$a=l5U:l5+p5}ԣ|54145D$D$4$@b]EE]UȋM; JU`=?0=l59|"&R9ߐt&Bd5ىl;J~ԡd5\$D$$蛶uÉ¡h5uȅ|5ЋM̋4`v ?J)EEރEfUE54* 4B9E 4MԋUL/uJt : |54544M؉U) p5U׉Mt}) JVUUU)ÍA9 u) }؅  9uf~uU2 4t`5u;54t&`5f J1ۡ44D$x5 |5$4L$14|5);x5~ 9UPUԃ#|5))¡J59~544)\$$54/$#a44 44444 444444/t 4 |5x5Me3  |[^_]Ívh5UJ(}ȅ}f1vډuvvU١d5)E5\v? EEEE0$EEԉ\$D$ D$D$$euJ9|34+]B9E MԾE)ޡ4 MEv?\v=?EuM; DJ:0U\v44D$4$ 4M4M|5;x5;5hRh?[J+4$S$V$D$d6nTڃ@ҋx5eED$ DJEED$0D$E$SE%))4 L$$4D$4$l5E4 4D$4$谔44D$4$蒔44D$4$h44D$4$J4%49E}a9|]<J$954|84484$\$$;54u$+U벋ME;4 42$U4Pt5?]K|5t4p54O?5;4~Xd5tOJtD$` D$$Ud5\$$3Ov ?44548|5)t ;54@Ov ?t ;54&=44$|$Mp5|5u2; 5J)ȉ$u4U54<)n4U]؅;=9u{uvD$ 4$Ot`5E܅su܉4$ Sã5Eԃ;|V‹M%))4 L$$m4D$4$RE4E\$t$$YNMU5|5Mv ?JEԡ4T4548)LMv ?t,49)؉$0441 +x5뻡|5J+45 )\$4$1~ M܀y kJ^D$` D$$}Ru47JMD$D$ $転Eԡ4d51P+|54Upgt@P5\t&USt =6tkt =6tĤ1[]Ípt$J\$D$@;$N16Ĥ[]Í&pt$hJ\$D$6$`N\$D$7$HN\$D$8$0N\$D$ 8$N\$D$`9$N\$D$:$M\$D$:$M6'Ut5!ɍt&{t&'UH%`]uh}$I$It$\$$Mv t"#󥋕]u}]Áhv ufU]ӉuΉ}Ǎl$Hډt]u}]Ðt&hD$t$<$fLUt6tM6t 6t1Ð@;pv L16Í$@6GD$$@6PD$$@6PD$$@6PD$$@6pPD$$@6\PD$$@6HPD$$@64P66$5$GD$5D$@6$(O6v @7v ,8v  8v Dt 8un`9v :v :v 6D$D$5$`N&tD$D$ 8$&Jot&tD$D$ 8$I>t&Ut 0$pU /3@;vU$Ё%/Í'UVSu /wupt{x$DE\$D$$LMt$$KKEt$$OD$\$$M%/Đ[^]ft&pUE]0 ÍUE]0Ðt&US]$RJ$胉\$$J[]ÐU)IEDBɃÍU IEB Ít&UHEB Ít&US]HڋDXt EGӋ[]ÐUS]HڋDXt LӋ[]ÐUE E EE] D&UWVSE $@INjE$3I9ljE@1t&E)9,|$E D$uމ4$@Lu؃[^_]Í1[^_]Í&'UWVS@JDJ{9ÉE 0D<~t?< t8< t4t&x+v< tx B< u9&< t9u~ Bq< u< t < t 9ut&΀;~t>1[^_]Ít& 0<~X$T\$|$$Gf)C$E0\$D$E$CE$ËE$9Et$|$$5G1[^_]Ít&'U}U }]u9~Љlj)C$肆=0\$|$Ɖ$B]u}]Í&US] 09|.t& 0D$0$荅0 09~׃[]t&U$1ÐU$耽Qvs;%/t&S;u/D$$IDU]&US]$bHu ;1҅u []ÐL\$$A1҅ƒ[]Í'US]DXu ;1҅u []ÐL\$$SA1҅ƒ[]U1]É'UWVSEU[t~1ۍ&[9ލ[<$g[D$ED$$g8u#v3#$B[^_]Í@J$v.t%$?$QB1[^_]ÍE$D$$g i?"t&뀍US]=/} tr/;;;u,U $ ;1;[]ÍvU ;mҐ ;u&~*;!‰;뇐t& Ӑf̍U1ɉEU ] U;t'@J$-;;$.>1ɍ&Í&U/]u}=~ t%=~ tI]u}]Í&;tء;44$B@J)ljxt, 09:u9T$t$$Gu&\$<$8;=@J;y ;;D$$1I'U(}ǡ/]uUus;U; Cޣ;$D$荀ڍ;/u-<5;]1u}]Ðt&; ;puƍv EM $lA<$bAD$蒀ËEtyU$T$A|$$DU$><$>;UQv$> ;1ҍD u $|$$xAE$D$)D녍v;1$1ң;t&U@JAuڃ1ɃuL$<$=tp 1[^_]Ð@J҉z q h/v\ ҉@JAt t t/uډэ&%@J<;+/<A%/E Et&{Ít&US/u`/u< /1[]f;t$1$ q\$$s2$W빐t&뮍&'U;t$/;;<<t$.;<%/Ív'U;t$.;;<t+B;B<;$p. ;tÁ%/Ít&US ;uUt&s ;tA<tء/<tHt<u3v1ۉ؃[]Í&'U <<A9|) ;t=B $<D$n <;U;Q<DÍv<$n <;뿐(<;$<U]Ív'$< (<U9~6P)1Ʌt $<x/$<U@<]Í&)ō$<ō(<;$<U]Ív'UUx]É'$<(<U9~F)1Ʌt3}UtA@<=(<~(<]Ít&)뵍/ /뤍'UE /]/1Í&U1/%/]Ðt&UVS u]tR' ftVvu.4$'D$\$$*uE [^]f/u [^]Í4$d'$hyt&ԍ&'U8/] ul}$'1҉ى󫍝 󫋍l\$ t$UUET$D$$?.]u}]ÍUSEx"x[]fUWVS,/Ed$.& щ1󫍝 dEEED$dD$F\$ D$$_-%ÍED$D$T4$c*M~}$<(<9~)9~E=EteEt0E/$É$xt t t&uɁ,[^_]Í1,[^_]Ív)낐EtE$%Ѓ;tD$D$4$.D$4$ÀD$.ED$D$4$'E\$D$4$.MY$1v=t&'US//t %//؃[]Ít&cu <t{$<9(<t.P@<1!‰؉$<[]Íҋ$JuVGx <u낍$J ht&$<9(<u/$B 8UWVS ]$xh5(<Nj$<9tIf@<1!8u%/lJt>tfɍ&Í&U>u#>t 0$RfUWVSlJ'`>ID$$I+twat&$t&át>$lJ08`5>ulJt & //Z @>D>$҉á@>$J.4t=$J4 /gY/L[^_]Í0 / t70wn$Í@v/ Of[49t&)t&SvvD>t$D>t4$8/%=t&1$C[^_]áJ$7u/%=~/vvI`>'4D$AD$$PD$ $,&US] E$;lJ /[]UUM tJtJ] UT?Mt+P?t"} tt,D$` D$$#; tɍuD$` D$$z#Ít&UEu#8?tD$` D$$F#á4?uݍ&썴&'U?t!?tD$` D$$"Í'U /tt1t1Í&$D$$$1f?tD$` D$$k"1ÍvU J$ D$%1ÐUVSJut;~+1ېt&JD$` D$$"9܃1[^]Ív1ۅ~f J$D$T%91[^]ÍvU JD$E$*%Ít&U JD$D$ E D$E$"Ðt&Uu5?]u1]u]ÍE10t֋8uU$T$%u؋뭐t&US$?D$ $yq(?D$` $dq,?D$` $Oq0?D$ $:q$ C? ??*J$ 6Jf:v$W ?$W?UEJJ$1Í&U]]uu =t]~J~? 5JtJJJ]u]Ít&FJ׍͋]u]f/$딉'U]g&U/u Í&/$OD$$;=[ tbfU/$D$$Ð@JDJU9~&@JEt  D>@@1 UE]@>4HP&U/Euɹ$@> D>@@1 UVS]u th?u_tE@J&~VD$0D$$b~܅fu&@J1[^]Éu ][^]/&@J 1[^]ۉu ][^] 'U]]uu tt ?ujtN\$D$ @JD$0$|cáDJ9| to9@Jt_DJ@Jx(]1u]Ít&u u]]]t&DJ̍t&ۉu u]]]bf 뚐D$D$0$?aq&U]&U]&UVSuE  v@Ju>&v@JX0\$$a$uCۉ@J~9H vǡ?u@JD$D$0$x`뤍t&@Ju>&n@JX0\$$?a$wtCۉ@Jt9 vNj?u@JD$D$0$_룍v1[^]މE u[^] t&'US]E et&@J;DJD$0$~`$@J;DJu;t&@J;DJ@J}kD$0$2`$jtNv?u@JD$ D$D$0$`;DJ@J|f/1[]Í&@J;DJ@J9D$0$_$%v?u@JD$ D$D$0$_ۉE ][]#vUx?$Jt@J1;DJ ‰ /t80t @Jt/t'1ÍvDJu1f $uet&릍&'US /@%/ ڋDXulBty&Avf1[]ÍvCtkDu䍶v ?\$E$1[]fӋBu\$E$1[]Í&Wv ?t5\$E$1[]Í\$E$1[]Ð\$E$1)t&\$E$It&Ue|$}0$D$X$|{14É'U/u\|z14ÐE D$E$v1fUuu]}} 4$ ; 0}9t$0$ DJtE]u}]$뽍UWVSUM 9~ȉщ¡DJ9EM֋E!։D$4$})EDJ)9}'>t&0 DJ)9;tHE$DJ0)DJ[^_]Ðt&;UkUc&Et$$D$ ED$UVS@Jt 0T t} tx5DJ9~ 0 t> t39tD$$@J @Jy @J1[^]Ã9ƣ@J~Q u捶t&ۉ@JtB< t< t]t&1KvU(]]}} u5@J;5DJ~Lt&v ?tm|$$9@J4$D$15@J]u}]Ív/uv ?tC@JBD$$~1f|$$|fۋu]}]]BfD$ D$@JD$0$ Z@J SvUVSEU @J /t-T$$@J$D$1[^]Í&t ?@J0H @Jt\$ $t@J;DJt1[^]Ðt&؉E[^]ыDP@tϡ4tƉ$\$|$H{1S@JD$D$0$2W\$@J$1fvDJUMU t;@JtU M]jf]3fDJUMU t;@JtU M]:f]RfUWVS}t?uEE[^_]Ð<$ƉEtDJ; 0DJ@J9|" v0 @J9~0t$|$$R;u*tO@JD$ $D$T$z0DJ5@JDJE[^_]f;tzuJ; @Ju+BAB멍v$ؼvU1WVS}@J=DJ[@J;DJ v5?@J)ã@JC$B1ɉ1~"t&0@J9@J$D$r@JD$ |$D$0$0V$@J4$R4$~1[^_] [^_]Í@JD$D$0$*Tt&v =?t@J@J@JD$D$0$SύvU(@J]]uu }E1u ]u}]Ét$$@Jt$$El=@Jt$$Z@Jt$$E@J9}E9ED$E$'<$ƋED$/E=@J<$D$4$RE@JED$E$$0E@J4$$1t&SE@JUVS0J@Jt|/t$tQ0:t0$D$ $1[^]Ðt&t$T$$ut$$f^ z&'US] E$D$E@J$؃[] UWVSÃ\5@JUeE1D$$E@JUiEEE4$D$;uEfEu9u0t$$Qv ?VU$t}t&Ot?u ÀDXu:ڡ00u9ugE@J1Ue3e\[^_]fӋ빐0D$ D$t$$QE:&Eu9E3WDX\ӋLt&E&ED$ EUЉ$)D$0D$t5]Љ$a$Vf1Eu v]Љ$,$q;EfUD$E׉T$$@~D50U׉D$T$4$.qt&'UE] UE] UE] UWVS<]eE1! ?d?pE`?U X?5\?D$ X?h?`?D$ED$h?$W2a&E1-`?X?\?&U EUߋE=}Vt ? ,E $I1&Ue3 <[^_]É ЃUЉ$:UЅ҉~*E1ۉEfUȍt$$T$ 9]v]~<$)]uډ<$1d?a}1G$:U߉UȉE1~'Eȉt$D$E؍$9؋Ud?$~Ẻ$'1t&U EE$UR1v`?D$ D$h?D$E߉$5`?`?D52fEd?vX?5\?bfE߉$1d?Dt&h?ED$ D$i?Eߡ`?$h?`?D$X?\?fUWVS @J}E11~wt&E $D$@J0T$$7p9~6@JD$E$@J;DJ|DO 1[^_]=/u@JD$E$@J;DJ}t&D$ 4$@J [^_]ÍUEU x0 @Jt6 t U EU Et&؉EEt&[Ít&UE ]0U]uƃ /@/ÉЃ࿅ۣ/xt\$4$]u]Ðt&vۍ&'US]/t%$@> D>1[]ÍS/u̓[]>&'UE]@>4&'UWVS,}eE1u  v ?r19ߍv~Mv ?tUt$$@J;DJ}t$$91Ue3uJ,[^_]ÍU$%뮍vvōED$D$4$y=s =UUE tE U]f]UWV$ ,tp8tkD$$Ct&P&00^_]$% 謃t8u$ 藃t 8gD$$jKAt& jt&1^_]Í&xLސU/J]ÍvU1]Ít&'UE]Ív/Ut1}]1f15]Ðt&UE $D$ù1 US]D$$C0t$\$$ Ë$=Ct$.$&]1u]ÍUS]t*t$Ct$][][]fU|?t$|?1Ít&'U|?tAD$$|?B;$YDJ|?@J1Ð1Í&US]u 1[]Ív=CuD$$x?tLtBDJ@J9~@Ju9=y@J1[]fDJ@JtǃG1;@J!‰D$J$~ /uɍ&Í&fÍ&&[ɐt& U[J / U%/t1Ð*v'US] /u$0[]J\$$$D$Cl1[]ÐUUB?BJBJB ?t ?]É'JU]JÐUJ]ÍUE;Jx?t J]1]Ít&U?]ÍJ;JUu1]Ít&?t]É'J1Ut?J]Í&'J1;JUt?J]Ív'UE+;J}x?t]Ð1]Ít&U]]u}|1 J9}'t#5?txEtU 9Pt(]u}]ÍvuMxU}x֍1҅E 9~ɋt&t} 9xuUuދ}UxӍt&'U U$t$|$y1ɉȋ$t$|$]Ðt&J9}ޅtڋ5?tЍ|Ƌ9CJf?Uu J]ÍvJ?]Í&U?]ÍU$~&¡?JBJB?BB ?tBfUWVS ?tG0tAE&$ËF$wEuڋE [^_]EE [^_]Ðt&Uuu]}y1]u}]Ð;5J}$ %E?t.(u0<>ft<f<<fEf t&'UWVS<ɉUƒ}EԉM ˆUtEEE1EEt& 8?}Eԉ~9Uԉ‰U}tE9E 9}UM̉E;E+]C$U܉\$T$Ɖ$ME4MMt+EԋME܍D9v ?EuE<[^_]Ít&E ED$E$wE\&5tMEԃUԋME\ ut&]D$4$)uًMMt&U1ɉE]'UW1VSE] $EE1tUq'UWVS\uȋUD:;E볍vUT$4$)~ύ\떋]܍v;]܉]1+E܃$M܉E19|pUEȅtEȉ8>EtCUЉE؋Ue3u{<[^_]ÍDEċE9Eu EԃE؃89}E\tʋE؃89|svEEq/v/t&'UWVS:vt6 ?tÉD$ $IuE;Em&)C$ۉEM܉M؋EE̅\U؀:?Mċ]Љ9;u=?$?$$-\$$Eпp t&UD$$ׅD'҉EJJ ?t$#?MЅ ?t$ ڋ]M6U1)ҋ<~1ۍ&$U9|Dt\&$u4$=?Ub&1ҍYTBЃC< vEă8w$t&vMȍz}M1t&Jt_JzfUȍEEED$$t$t$EȍMEԉL$$O%Itt&JMУJ $1_t&E18P &J]$v~t&[EЉ$vUȃ}UE2vE؋UЉ\$D$$t&J)Љu1!$1@EJJEЉ$1_UWVS|} EEMeU1EEE$MuE\1v ?E1MD$ED$ $E} U]U1ۀ:7%*$f1-t& ^& ] ^**-MU\$<$T$c?$q$\$$ $EEEEEEEU<:(MTgaGQBD1U8 UE EEEEEEEE|>E;E!UMU]E9]]Euu>uE¿v ?l ;E?;E,<"<Wt&3vE$$UT$$M1f M8L$$JtU|$$ЅM9E4$D$)T&ҍXfavE@UMT$ $REfqMUDD$$-U<Bu"Wt&v+EEUEE]EEEU MEAL$$uEF;]uč]؋! t€҃+|U4;u|/9uM+EMEUD$$EE)ލM؉L$$t&'tI\E;EME\M]Et&Eu?Tt&E;E!UM MU M ]E;E U+EEE"E]&}1t/uMD1lD$$ĻP]+E$%UT$EЉ$uЉ4$ʿENjE9E(+EUMUT$ $GuЉEEt$)E$1EЉ$t&UMD EMԋUD$EЉ$Ej}uЅt>E4$踼1EEԍXGMWD9<'Ho'uet&E@MEL$$REof҃+|M $E$ft&UM}D 4 t<'tP+]$X\$t$EЉ$ٹEDuЉ4$EM9M*U+EMUT$ $quЉEEt$)E_$XEЉ$=t&'t&HfSvE@EUD$$EfE@UMT$ $EfD$$fE@EUD$$EfE$*E MAA:AsED$ȃ$pEEЋUM $DU9UM $(f4$tENjE9E(+EUMUT$ $uЉEEt$)E$ۼu1臾EEt&U]Éu}t;$׻$\$$pt؋u]}]Í&$Uk JtN$舻P ƍ@E$|$É$3/U.his@tory@됍}  E믐&UWVS<AED$\$$E܃Ju97JE+}EU9~n?UEEЍ4%t&$肺U9}DE~/]Ѕt؋Ctр8t̉$VUDE븍EE$VE8J+U9ЉUE14@D$E$觺$U̍ EU9J~Kx?tCt8tD$E$SC$薹U̍ xzE1ۉD$ỦT$E܉$yxiỦ$E܉$E؅t U؉$ݶ<[^_]Í&ETu؅t E؉$貶<[^_]Ðt&뎍&M؅ɋt U؉$sE܉$xfUJE]'U1ɉUE ]o UE]}uvD$D$lj$`tmED$\$$t9E%=tR$<$詵]u}]Í0$蕹ҍ&0Eċuus$^蹱됐t&$费E?Et$$D$薴$ M EɍT0эv9U?B9E€: u8t9UUD$D$<$E$1+ED$ED$ܲ$tE$Y9ЍU?ѐ: t+} эBuщ7&9Es֍18)E ɍt&1tf_0놉$1t&&vUWVS|E/D$D$E$xvED$|$$˹tZUċ]u؃sq1x<$gEt E$Et4$9|[^_]Ív1蕯ux‰<$!t&볍$|ƉEzE\$<$D$\x<$޶E }9}M1f9stXE9va{ ؍Su9v{ ttCt):?t1 $EtE$E9u~ىfMEt E$"E1ۉ$t&CfE vAE1?Mx t(9w "f;u t&|ލ卶8‰ft΃lj]&UED$D$$ÐUHuƉ}=J]Mu؋u]}]Í8tJt؉9ttx&4$EL]EСJE};}tUE܉$9E}}+]Аt&x{UЅtBE؈UE&mxTEU:uUЉD$4$T$-uՉ=JfۍfOf1}&uv#+EЉEؐt&xEЅ1ۋU܈EUvE9]|UE8uEЉT$4$D$肶uPMЅt)U:uEЉT$4$D$QZ=J11 UEU ]U1ɉEU ] Uu]ƋE$E D$E$tf4$l؋u]]É4$SUWVSU Eu})9|~/E1:tt&1[^_]ÐC:u9[^_]Ít&'U(Euu }}]$蔰Ey]u}]Í&9|1ۅuv9ލv~~EU)څtPT$|$ D$$<Bvtt&vtG뢍&$D$D$ 벉)C&UVS]u $讯t6t$ D$\$$袬t1tL[^]Í&D$D$$蠴ftFf뺍tFU]]uu E}D$$:~ EUET$E$~9t1]u}]Ðt&M:ut:UMD2U:D uɉ޹]VC8u9UWVS,EeU1EEE$CM ɉE9E UU 11vED$ E܍U$)؉D$E؉D$ƍ@vJtEu'ߍ9] Ue3uC,[^_]Í&E$Ѳt̐ǍE߾E묐1 U(eE1?]]uu t3Ue3uU]u]É$,@9}ՍE)D$ 3D$EEET$$wE럐t&Ot&'UWVS,E}eU1EE܋E E!…U~?T$U܍ED$$U49֍EE~Bu=EuUe3E,[^_]Í&tɋ]$ UT$ \$D$E؉$@v tEօtE$뫃EEf]$跫U\$T$ D$EE؉$誨u9vۍ(E$t&菰]]]$VU\$T$ D$E؉$LÍ@v藭U]ˉuƉ}t8u:߉<$$-1|$$莫؋u]}]Ív$ª<$E跪UD$U1tt$$AE럐&UWVS1ۃu>~F7vUWVSLED$~$HU$uEȉ$EEEU؉$HUE<~u؋EEЉto]Ѕ~hUEU]UU܋u؋]Uf^$֧\$D$NjE$AuыU܍|:}ЉEE9EȉEE\$D$EẺ$V]U]$oEE߀;/MEƅuv^$\$<$D$莫u֋E EEԃ$,UԉT$ËE$D$訢U$E$_4$跦U9UȉUUEUEĉt$U$;4$#"fEU9UbUEԋ}}Ԁ</E ELUEL[^_]fEE1E9EȉEzUȋEЍTUȉЋUD$$EQt&EE9E]#UȍDEȃD$E$dE EE$虥Eȉ$EU<U~<]É'U /]] u}u 8uE\$$H1]u}]Ð\$$(]@J0t}c)KvDž`[Xxߍ41Dž\4F$D$Lt0~\tJXxtF9t.uuF9;`)\1묍l \/$á/$۝l<X@JEE @JED$D$ D$t$$"1@J{\Dž`(Dž`{&UEu[D$D$ $)D$D$ $]{D$D$ $}_Ðt&D$D$ $)$ @ tV& ED$$T$4UD$$ÍGD$4@SU.\E8.uuHL.ue1ۃx\&ED$\$$xE%=@*JUe3e[^_]ÍvU1ۅt$軘Et$謘@ <.t<\. |$D$$Lc$贜Ë <$|$葜ۉWO3މC<$L|$D$$胝v \$$(CDž Džv$É1҉tA ;r틅 =u44$vې; u4$v.t&f <.U<\z.&7v$虚tyu\(h(11t&1; ! F$E4$;tދ uNjF$ ዕE8.2U.'\ \$z.;@G<.&fv(D$\$$Jt8%=@^$褗Nj $蔗D$訙 $x$荙 T$$\$4$ؗD>>/$T$辗ED$t$$跔4$1腔 D$ƉPDžDž 1z.t&ff1Dž뼡($ 4$11$Džv1ۃz.t&UWVS,}$,ÉED$/<$蹒}1E䝘EE$gUD28/E E܉D$U$o}Eu}JU}]U܉D$T$E$P=JM ‹1 t uD$U$NE4 t#؍& HuU$CHUtӐt&$CuE$vE,[^_]Ðt&U:f$ؑU } T$D$E$=J‹M EEEtE$胑zUtӍ&$dCuE$O}tut U$6(u(<EE,[^_]á($҃)E؍F$jEtÉt$|$$胖E0UEULE]U$衐]FE$膐EUE^$jU E$T$LEJ9voۍPu[&~.]vf}R»uÐ1ۃ[^_]Ít&()tJtލ‹t&댍Ӄ[^_]Ã|uߋU u؃}|t&uΉÍt&렍uUҐtm‹7tMu{9Uvt‹Evu9ƒ!tq^Eti&JE;ƒ:t.t =MM9Ht&t‹Ex}돍v'UW1VSUPUPE҉Ut9U11EvUTt.uU|]uڋ`t@` t/E9uU|$$T$豓uًEuϋFf1 E]tUU[^D_] U]ډu19t)D$$軇u)؋]u]Ðt&UW1VSUPUHEɈMt3U1Ev}T8t.uMU|]uߋtMt7E:uU|$$T$u؋M< uVvU1 ‹EtEMU[^_D]ÐUWVS|EU!;MEu E U M؋M EԉUM̉uEEЋEԅU19UvM9Et uЀ>(u?t&V*vEԉхr9u{uЉu؋EE9ErU9UE tWM19/Of[t{\uu9ut6E fU9։Uru؅ 9t|[^_]ÍvljDX&tu9utE ft .vCEԉMfu(;ut& ?*U„;uE u }\f%]܋UԅM̍~9MdE ۃ}[]EǃEQv>(t$D$̂t9ED$U$UEEM9MEu}tEԅJM;Uu멐t&/t&}fv>(t&E9E̍t&]̍&9]lU ?T$Mډ4$L$MTuЃ|1[^_]ÍCփv?t@t!vmfU9ŰE tE D$M؉L$uЉ4$MUt&U9U,]̐9]M ډL$E4$D$M*uKv]Ծ\ۍqfO\EȋMȉDyU萈FfEЃt&v/t& fv&߃Dpp)av跃]DXҋEf}[UЉU!voڋDXk踇4[y=t& y]Eԅt&|EPEUUrU؉\t&MEQRȃv::xu]u+]؉$蹅ECCD$E؃D$u4$†DE0 t&t. :uD$M $؈u؅t EvE$豀EEmMd] ;&]u \fɍ"uE[uËu<=t<:t<.uɃ뾍U2E<]EԅNڋDX藅4]؃}t<\u ;]؃+[3Mԅ]]Љ]tgUԅ0軀ًDXhEEErU1ɍFt&EvzE؅&cv7҉UDP2}M<3.؍UËEE3xt&DXEunt&u^DXpat&oUDX赃E}t&$u0 UM}_ ƒ~uT0~M ~u0~M~u0 mx~MWb~u0 >I~M&1~u0~M ~u01EEt&}DxhXE؀8E}?b}*Ru&E&UvU}} Euu]EtAt=<$)~4$~M]M uE}]&]u}]Í&'UWVSÃ(?$t&wn*vEt&9]&EEċUE9UoM9ME u1>/[\uu9ut&tnE fU9։UrS}Ål$}: M $}Iu4$\|E6}[ Ue3e Č[^_]Í&$t}$|Ív}tU9UtE t}.& ut&0M!ƒ^ ЃEȋEĐ[MMt \ Eۍv EċEE t /E-t&9}M=`D$`$h hr][}Eą&vM9MfrE u~/UuE${U$pzEt&E9E4E t.}.fu&U9UE tMy/u>?*„<M MDt&M̅t4dEEE9EEvEEt t >(W;ut& >?*„;u E t&u \v}EY MV9MUE Eb&>(t#U$\D$ rt 'fUMET$U $MEE9EẼ[ÅutEM9Eu룍v}/}fBfv>(t&E9Et&9]M?U 4$L$MT$$ u1EvE t }/E t&}.U9Ut&My/t&kvCփfv?vt@vt!v=fU9UE tE MuUD$؉L$M4$Q t&U9U]9]M ڋE4$L$MD$* uvuvfmvuċ=:&.2EčU}E}t&Uċ2]X}Ut \%[fEȋEUȃ9U=h5`D$`$h n]Evj$VwZ$uKvE4t&ҍIfv}/t&f[vM $fvhu4${uEUMċ2M&9umMċ] 4]_u \fɍcuċE[uċuċ=t :t.uȃt&뾍E5`D$`$hhlR<$t&u%<$tv$u$^t v~=t&~ ]]ېt&EċX;]]UċZUąMa$MuQ$sÍ&;vuEVt&:xu]u+]$rED$EăD$E$sUDU$Tn]D$$qEt Eࠢ$uEEUkjÃ$pqEE$2kkjt$ u4$ÃD$ED$ovUE$mU$ltAUM\$ $rF}_<1E}4$VlEE$DlEUċ ɉE]E^ $JsN$qÍt&;vt&vuċ>ku0U1ɍF3]D$t$%pDM $lUUb$8q^$r$qvU$Or?$pv1EEt&EeEt&SU44$q)4$opƐUȋ.EȍUEȋEuMȃM$qo$pvaEċ0EM $DqE$oEnu\$4$oEcn?t&r*&bu& E&E&vU}} Euu]EtAt=<$g4$gM]M uE}]&]u}]Í&'UVS u] qfEt$D$$vhE\$D$$v>ED$ED$E$ ËE$thE$ih [^]Ít&E$QhE\$4$D$J É[^] UWVSà ~/.bashrcCOMP_WORDBREAKS%s: invalid option%c%c: invalid optionemacsEMACSdumbPS1PS2SSH_CLIENTSSH2_CLIENT/etc/profile~/.profile~/.bash_profile~/.bash_logindebuggerdump-po-stringsdump-stringshelpnoeditingnoprofilenorcposixprotectedrcfilerpm-requiresUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... -irsD or -c command or -O shopt_option (invocation only) Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. %s: cannot execute binary file%s: option requires an argument/usr/local/share/bashdb/bashdb-main.inc7pItimed out waiting for input: auto-logout PROMPT_COMMANDeterm/%s TMOUTreader_loopPIPESTATUS ; readline stdin ;|&syntax error near `%s'syntax error%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M%s.%dHOMEesacevalexpected `)'-nUse "%s" to leave the shell. "$@"memory exhaustedthenelseeliffiforselectwhileuntildone[[-p&&||>><&>&;;<<-<<<&>>|newlinessVA$                                                          >   >   >         > M   YYoo/mhlIl+lkkk}khhqh2hhgggnnUn*nmmmTm]]l]:]]\\\Rk;k$kkkjjjujhj2j%jj jiiiiiiiiriiqrqqXYpYp poGg gfcfee%ed_ddccbc2ccbbb|bVb0bbbaaaaYmaOa```Y}`a`0aYp`Y?`Y`___r_e_YYU_E_;_YY_^^^m^8^^^]}obo;oonSrFryro {();&| $   R$+RR.31!R+RCKWZ_rwRRRRRRRRRRRRRRRRR{bR)?RRjR)ReqRRRRRRRRRRRRRRRRRRRRRRRRRRRRR)RRRRRRRRR?RR"R)RRRRRRRRRRRRRRRRRRjj)RRRRRR,RR-6RRRR"RR)RRRjjjjjRRRRRRRRRRRjRR"R RRRRRRR RRRLRRRRRRRRRRRRRRR\RRRRRRhjjjRRRjRRRRRRRj!RR" RRRRR,*451+0/2.3  !"#$%&'()- $:..5589;,>1 3 1,A+,-,c22,,gh,k44244.,,x22|},l2,rijj2z{,2,*+2,121,-+,-+++,-4533 !"#$&'()/0 !"#$&'()55/0   %*+,33%33 33" !"#$3&'()3,-/024  !"#$&'()+,-/024  !"#$&'(),/024  !"#$&'()/024  !"#$&'()/024  !"#$&'(),/024  !"#$&'()/024 !"#$&()/0<=@b10|PQ]^T9Uwy:~szRqV 48mnos;{>Bsss?Ckss NsOs11SWXs'( ghsYijZbs[11\demnogh_11xr}mno`  "!#$)   % & *,a+- A l mno s   s DEFGHIJKLMzzz%&Zzz'*,-0:41/65789|jzzzz  "# %+(.uvzz}~zxwyz{iktzzzzzzz[z !$ YU)zzzzzzzzzzzSRzzVmnl_zzzzEFzzzz23TPXopqrsOe`Mg;z<GzHQWzzzzfNz=>zzCDIJ\zhabzzzzz^cdAB]?@KL  677778899999999999999999999999999999:::;;<<====>>>>>>>>>>>????????@@@@AAAAAABBBCCCDDEFFFGHIJJJKKLLLLMMNNOPPQQQRRRRRRSSTTTUUVVVWWWWWXXXXXXYYZZRRRRRRRRRZRRRRR4RRf^RSRRC !c"#$%&'()*+,-.56tufp7/v23syntax error near unexpected token `%s'syntax error: unexpected end of fileunexpected EOF while looking for matching `%c'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expressionunexpected token `%s', expected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional unary operatorunexpected token `%s', conditional binary operator expectedconditional binary operator expectedunexpected argument `%s' to conditional binary operatorunexpected argument to conditional binary operatorunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional commandunexpected EOF while looking for matching `)'=~:~OLDPWD/dev/tty`%s': not a valid identifiergetcwd: cannot access parent directories%s(%s) clean_simple_commandexecutablesyntax error: `;' unexpectedsyntax error: `((%s))'make_redirection: redirection instruction `%d' out of rangemake_here_document: bad instruction type %dsyntax error: arithmetic expression requiredabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ %u! ) && || [[ case %s in select %s in for %s in >> %s<<%s%s <<< %s%d<&%d%d>&%d%d<&%s%d>&%s%d<&%d-%d>&%d-%d<&%s-%d>&%s-%d>&-<> %s>|%stime -p for (( | if then else %cfunction %s () { } { print_command do () PS4(( )) '' ]] case %s in ''%s%s=(%s) cprintf: `%c': invalid format characterprint_command: bad connector `%d'ؠ С0`px`Ȩ`Hئإdispose_commandغйh@غй(йxcannot duplicate fd %d to fd %dcannot redirect standard input from /dev/null: %s%s: restricted: cannot specify `/' in command namesTIMEFORMAT: `%c': invalid format character/dev/nulleval_builtinbuiltin_envreturn_temp_env%s: %s: bad interpreterELF%s: %s: bad ELF interpreterexecute_cond_node%s: readonly functionpipe errorpipe-file-descriptorsloop_redirectionsexecute_connectionexecute_commandPS3#? LINESCOLUMNS%*d%s%sfunction_callingexecute-shell-functionsimple-commandfgbgauto_resumeexactsubstringsaved redirectssaved_redirects%s: command not foundreal %2R user %2U sys %2S real %3lR user %3lU sys %3lS?.<"@[{$d pop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextpop_scope: head of shell_variables not a temporary environment scopeall_local_variables: no function context at current scopemake_local_variable: no function context at current scopeshell level (%d) too high, resetting to 1error importing function definition for `%s'IFSBASH_ARGVBASH_ARGC_=OPTERROPTINDignorespaceignoredupsignorebotherasedupsHISTFILE/dev/urandom%s=PPIDshell-initSHLVL() {/usr/local/bin:/bin:/usr/bin+ i386HOSTTYPEOSTYPEMACHTYPEHOSTNAME60600MAILCHECKBASHBASH_VERSIONBASH_VERSINFOBASH_EXECUTION_STRING~/.bash_history~/.sh_historyIGNOREEOFignoreeofHISTCONTROLHISTIGNOREEUIDSECONDSBASH_COMMANDBASH_SUBSHELLRANDOMHISTCMDDIRSTACKGROUPSGLOBIGNOREHISTFILESIZEHISTSIZEHISTTIMEFORMATHOSTFILELANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICLC_TIMEMAILMAILPATHTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRTZhistcharsnpp@pnnooppoo`ohq(null)last command: %s Aborting...%s: %s: %d%s: line %s: %s:%s%d: %s: readonly variable%s: unbound variable%s: warning: bash-maintainers@gnu.orgunknown command errorbad command typebad connectorbad jumph ~   expression expecteddivision by 0bug: bad expassign tokensyntax error in expressionrecursion stack underflowinvalid arithmetic basevalue too great for base*/%+-&^|missing `)'exponent less than 0%s%s%s: %s (error token is "%s")`:' expected for conditional expressionattempted assignment to non-variableexpression recursion level exceededsyntax error: operand expectedsyntax error: invalid arithmetic operatoridentifier expected after pre-increment or pre-decrementDDDDDDDDDDDDDDDDDD##################KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKʚKKSignal %d[%d]%c | %5ldDoneStoppedStopped(%s)RunningDone(%d)Exit %dUnknown status%*s(core dumped) & (wd: %s) %s: line %d: (core dumped)(wd now: %s) notify_of_job_statusSIGCHLD trap[%d] %ld [%ld: %d] tcsetattrno job control in this shell%s: job has terminated- [%d]%s (wd: %s)job-working-directorystart_pipeline: pgrp pipeforkchild setpgid (%ld to %ld)describe_pid: %ld: no such pidinitialize_job_control: getpgrp failedinitialize_job_control: setpgiddeleting stopped job %d with process group %ldwait_for: No record of process %ld%s: job %d already in backgroundwait_for_job: job %d is stoppedwait: pid %ld is not a child of this shellforked pid %d appears in running job %d@((((((((J@(((((((((((((((((((J@((((((((((((((((((((((((((J`[xxxxxxxxxxxxxxxxxxxxxxxxxx݄ЩXЪ8HHHHHHHHHHcommand substitution$($[>(<(process substitutionno match: %s#%:-=?+/}%:=+/%s: substring expression < 0%s: bad substitution%s: parameter null or not setcannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1bad substitution: no closing `%s' in %s%s: cannot assign list to array membercannot make pipe for process substitutioncannot make child for process substitutioncannot duplicate named pipe %s as fd %dbad substitution: no closing "`" in %s$%s: cannot assign in this wayYou have mail in $_You have new mail in $_The mail in %s has been read interrupt trapreturn traperror trapdebug trapexit trapinvalid signal numbertrap_handler: bad signal %dSIGEXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGSTKFLTSIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMIN+15SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGRETURNrun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselfcannot allocate new file descriptor for bash input from fd %dsave_bash_input: buffer already exists for new fd %d(((((((("((((((((((((((((((("(((((((((((((((((((((((((("""   P      p  8   H(    p @ h H    argument expected%s: unary operator expected%s: binary operator expected`)' expected`)' expected, found %smissing `]'too many arguments%s: integer expression expected%s.%d(%d)-%s%s.%d(%d)GNU bash, version %s (%s) 3.2releaseCopyright (C) 2007 Free Software Foundation, Inc. @(#)Bash version 3.2.39(1) release GNU ;|&( ;|&()'()'array assign%s[%s: %s[%s]: %sbad array subscript%s: cannot assign to non-numeric index%s%s%s%s: cannot create: %s500%s: first non-whitespace character is not `"'bash_execute_unix_command: cannot find keymap for commandfc -e "${VISUAL:-${EDITOR:-vi}}"fc -e "${VISUAL:-${EDITOR:-emacs}}"no closing `%c' in %s%s: missing colon separatorbash_execute_unix_commandcompletion-ignore-case;|&{(`$include hostname_completion_file/etc/hostssymlink-hook()<>;&| %s %dC-xC-efc -e vi "'$@Bashshell-expand-linehistory-expand-linemagic-spacehistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-history'" \"'@<>=;|&()#$`?*[!:{#comment-beginFIGNORE "'@><=;|&(: "'><=;|&(:v  POSIX"" /usr/share/locale#: %s:%d msgid %s%s msgstr "" redirection error: cannot duplicate fd%s: cannot overwrite existing file%s: restricted: cannot redirect outputcannot create temp file for here document: %ssh-thdfile descriptor out of range%s: ambiguous redirect/dev/tcp/*/*/dev/udp/*/*    @ @ h h @ (      h h COMP_LINECOMP_POINTCOMP_WORDSCOMP_CWORDCOMPREPLYcompletion: function `%s' not foundprogcomp_insert: %s: NULL COMPSPECxrealloc: cannot reallocate %lu bytes (%lu bytes allocated)xmalloc: cannot allocate %lu bytes (%lu bytes allocated)unaliasunalias [-a] name [name ...]breakbreak [n]continuecontinue [n]callercaller [EXPR]cdcd [-L|-P] [dir]pwdpwd [-LP]truefalsedeclaretypesetlocallocal name[=value] ...echo [-neE] [arg ...]enableeval [arg ...]getoptsgetopts optstring name [arg]exit [n]fg [job_spec]bg [job_spec ...]help [-s] [pattern ...]jobsdisownletlet arg [arg ...]readreturn [n]unset [-f] [-v] [name ...]readonlyshiftshift [n]sourcesource filename [arguments]. filename [arguments]suspend [-f]testtest [expr][ arg... ]timestype [-afptP] name [name ...]ulimitumaskumask [-p] [-S] [mode]waitwait [n]time [-p] PIPELINE{ ... }{ COMMANDS ; }%JOB_SPEC [&](( ... ))(( expression ))[[ ... ]][[ expression ]]pushdpushd [dir | +N | -N] [-n]popdpopd [+N | -N] [-n]dirs [-clpv] [+N] [-N]shoptprintfcompgenReturn a successful result.Obsolete. See `declare'.Logout of a login shell.alias [-p] [name[=value] ... ]bind [-lpvsPVS] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]builtin [shell-builtin [arg ...]]command [-pVv] command [arg ...]declare [-afFirtx] [-p] [name[=value] ...]typeset [-afFirtx] [-p] name[=value] ...enable [-pnds] [-a] [-f filename] [name ...]exec [-cl] [-a name] file [redirection ...]fc [-e ename] [-nlr] [first] [last] or fc -s [pat=rep] [cmd]hash [-lr] [-p pathname] [-dt] [name ...]history [-c] [-d offset] [n] or history -awrn [filename] or history -ps arg [arg...]jobs [-lnprs] [jobspec ...] or jobs -x command [args]disown [-h] [-ar] [jobspec ...]kill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]read [-ers] [-u fd] [-t timeout] [-p prompt] [-a array] [-n nchars] [-d delim] [name ...]set [--abefhkmnptuvxBCHP] [-o option] [arg ...]export [-nf] [name[=value] ...] or export -preadonly [-af] [name[=value] ...] or readonly -ptrap [-lp] [arg signal_spec ...]ulimit [-SHacdfilmnpqstuvx] [limit]for NAME [in WORDS ... ;] do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donefunction NAME { COMMANDS ; } or NAME () { COMMANDS ; }variables - Some variable names and meaningsshopt [-pqsu] [-o long-option] optname [optname...]printf [-v var] format [arguments]complete [-abcdefgjksuv] [-pr] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [name ...]compgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [word]`alias' with no arguments or with the -p option prints the list of aliases in the form alias NAME=VALUE on standard output. Otherwise, an alias is defined for each NAME whose VALUE is given. A trailing space in VALUE causes the next word to be checked for alias substitution when the alias is expanded. Alias returns true unless a NAME is given for which no alias has been defined.Remove NAMEs from the list of defined aliases. If the -a option is given, then remove all alias definitions.Bind a key sequence to a Readline function or a macro, or set a Readline variable. The non-option argument syntax is equivalent to that found in ~/.inputrc, but must be passed as a single argument: bind '"\C-x\C-r": re-read-init-file'. bind accepts the following options: -m keymap Use `keymap' as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -r keyseq Remove the binding for KEYSEQ. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. -f filename Read key bindings from FILENAME. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -V List variable names and values -v List variable names and values in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input.Exit from within a FOR, WHILE or UNTIL loop. If N is specified, break N levels.Resume the next iteration of the enclosing FOR, WHILE or UNTIL loop. If N is specified, resume at the N-th enclosing loop.Run a shell builtin. This is useful when you wish to rename a shell builtin to be a function, but need the functionality of the builtin within the function itself.Returns the context of the current subroutine call. Without EXPR, returns "$line $filename". With EXPR, returns "$line $subroutine $filename"; this extra information can be used to provide a stack trace. The value of EXPR indicates how many call frames to go back before the current one; the top frame is frame 0.Change the current directory to DIR. The variable $HOME is the default DIR. The variable CDPATH defines the search path for the directory containing DIR. Alternative directory names in CDPATH are separated by a colon (:). A null directory name is the same as the current directory, i.e. `.'. If DIR begins with a slash (/), then CDPATH is not used. If the directory is not found, and the shell option `cdable_vars' is set, then try the word as a variable name. If that variable has a value, then cd to the value of that variable. The -P option says to use the physical directory structure instead of following symbolic links; the -L option forces symbolic links to be followed.Print the current working directory. With the -P option, pwd prints the physical directory, without any symbolic links; the -L option makes pwd follow symbolic links.No effect; the command does nothing. A zero exit code is returned.Return an unsuccessful result.Runs COMMAND with ARGS ignoring shell functions. If you have a shell function called `ls', and you wish to call the command `ls', you can say "command ls". If the -p option is given, a default value is used for PATH that is guaranteed to find all of the standard utilities. If the -V or -v option is given, a string is printed describing COMMAND. The -V option produces a more verbose description.Declare variables and/or give them attributes. If no NAMEs are given, then display the values of variables instead. The -p option will display the attributes and values of each NAME. The flags are: -a to make NAMEs arrays (if supported) -f to select from among function names only -F to display function names (and line number and source file name if debugging) without definitions -i to make NAMEs have the `integer' attribute -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -x to make NAMEs export Variables with the integer attribute have arithmetic evaluation (see `let') done when the variable is assigned to. When displaying values of variables, -f displays a function's name and definition. The -F option restricts the display to function name only. Using `+' instead of `-' turns off the given attribute instead. When used in a function, makes NAMEs local, as with the `local' command.Create a local variable called NAME, and give it VALUE. LOCAL can only be used within a function; it makes the variable NAME have a visible scope restricted to that function and its children.Output the ARGs. If -n is specified, the trailing newline is suppressed. If the -e option is given, interpretation of the following backslash-escaped characters is turned on: \a alert (bell) \b backspace \c suppress trailing newline \E escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \0nnn the character whose ASCII code is NNN (octal). NNN can be 0 to 3 octal digits You can explicitly turn off the interpretation of the above characters with the -E option.Enable and disable builtin shell commands. This allows you to use a disk command which has the same name as a shell builtin without specifying a full pathname. If -n is used, the NAMEs become disabled; otherwise NAMEs are enabled. For example, to use the `test' found in $PATH instead of the shell builtin version, type `enable -n test'. On systems supporting dynamic loading, the -f option may be used to load new builtins from the shared object FILENAME. The -d option will delete a builtin previously loaded with -f. If no non-option names are given, or the -p option is supplied, a list of builtins is printed. The -a option means to print every builtin with an indication of whether or not it is enabled. The -s option restricts the output to the POSIX.2 `special' builtins. The -n option displays a list of all disabled builtins.Read ARGs as input to the shell and execute the resulting command(s).Getopts is used by shell procedures to parse positional parameters. OPTSTRING contains the option letters to be recognized; if a letter is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. Each time it is invoked, getopts will place the next option in the shell variable $name, initializing name if it does not exist, and the index of the next argument to be processed into the shell variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the shell variable OPTARG. getopts reports errors in one of two ways. If the first character of OPTSTRING is a colon, getopts uses silent error reporting. In this mode, no error messages are printed. If an invalid option is seen, getopts places the option character found into OPTARG. If a required argument is not found, getopts places a ':' into NAME and sets OPTARG to the option character found. If getopts is not in silent mode, and an invalid option is seen, getopts places '?' into NAME and unsets OPTARG. If a required argument is not found, a '?' is placed in NAME, OPTARG is unset, and a diagnostic message is printed. If the shell variable OPTERR has the value 0, getopts disables the printing of error messages, even if the first character of OPTSTRING is not a colon. OPTERR has the value 1 by default. Getopts normally parses the positional parameters ($0 - $9), but if more arguments are given, they are parsed instead.Exec FILE, replacing this shell with the specified program. If FILE is not specified, the redirections take effect in this shell. If the first argument is `-l', then place a dash in the zeroth arg passed to FILE, as login does. If the `-c' option is supplied, FILE is executed with a null environment. The `-a' option means to make set argv[0] of the executed process to NAME. If the file cannot be executed and the shell is not interactive, then the shell exits, unless the shell option `execfail' is set.Exit the shell with a status of N. If N is omitted, the exit status is that of the last command executed.fc is used to list or edit and re-execute commands from the history list. FIRST and LAST can be numbers specifying the range, or FIRST can be a string, which means the most recent command beginning with that string. -e ENAME selects which editor to use. Default is FCEDIT, then EDITOR, then vi. -l means list lines instead of editing. -n means no line numbers listed. -r means reverse the order of the lines (making it newest listed first). With the `fc -s [pat=rep ...] [command]' format, the command is re-executed after the substitution OLD=NEW is performed. A useful alias to use with this is r='fc -s', so that typing `r cc' runs the last command beginning with `cc' and typing `r' re-executes the last command.Place JOB_SPEC in the foreground, and make it the current job. If JOB_SPEC is not present, the shell's notion of the current job is used.Place each JOB_SPEC in the background, as if it had been started with `&'. If JOB_SPEC is not present, the shell's notion of the current job is used.For each NAME, the full pathname of the command is determined and remembered. If the -p option is supplied, PATHNAME is used as the full pathname of NAME, and no path search is performed. The -r option causes the shell to forget all remembered locations. The -d option causes the shell to forget the remembered location of each NAME. If the -t option is supplied the full pathname to which each NAME corresponds is printed. If multiple NAME arguments are supplied with -t, the NAME is printed before the hashed full pathname. The -l option causes output to be displayed in a format that may be reused as input. If no arguments are given, information about remembered commands is displayed.Display helpful information about builtin commands. If PATTERN is specified, gives detailed help on all commands matching PATTERN, otherwise a list of the builtins is printed. The -s option restricts the output for each builtin command matching PATTERN to a short usage synopsis.Display the history list with line numbers. Lines listed with with a `*' have been modified. Argument of N says to list only the last N lines. The `-c' option causes the history list to be cleared by deleting all of the entries. The `-d' option deletes the history entry at offset OFFSET. The `-w' option writes out the current history to the history file; `-r' means to read the file and append the contents to the history list instead. `-a' means to append history lines from this session to the history file. Argument `-n' means to read all history lines not already read from the history file and append them to the history list. If FILENAME is given, then that is used as the history file else if $HISTFILE has a value, that is used, else ~/.bash_history. If the -s option is supplied, the non-option ARGs are appended to the history list as a single entry. The -p option means to perform history expansion on each ARG and display the result, without storing anything in the history list. If the $HISTTIMEFORMAT variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each displayed history entry. No time stamps are printed otherwise.Lists the active jobs. The -l option lists process id's in addition to the normal information; the -p option lists process id's only. If -n is given, only processes that have changed status since the last notification are printed. JOBSPEC restricts output to that job. The -r and -s options restrict output to running and stopped jobs only, respectively. Without options, the status of all active jobs is printed. If -x is given, COMMAND is run after all job specifications that appear in ARGS have been replaced with the process ID of that job's process group leader.By default, removes each JOBSPEC argument from the table of active jobs. If the -h option is given, the job is not removed from the table, but is marked so that SIGHUP is not sent to the job if the shell receives a SIGHUP. The -a option, when JOBSPEC is not supplied, means to remove all jobs from the job table; the -r option means to remove only running jobs.Send the processes named by PID (or JOBSPEC) the signal SIGSPEC. If SIGSPEC is not present, then SIGTERM is assumed. An argument of `-l' lists the signal names; if arguments follow `-l' they are assumed to be signal numbers for which names should be listed. Kill is a shell builtin for two reasons: it allows job IDs to be used instead of process IDs, and, if you have reached the limit on processes that you can create, you don't have to start a process to kill another one.Each ARG is an arithmetic expression to be evaluated. Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignment Shell variables are allowed as operands. The name of the variable is replaced by its value (coerced to a fixed-width integer) within an expression. The variable need not have its integer attribute turned on to be used in an expression. Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above. If the last ARG evaluates to 0, let returns 1; 0 is returned otherwise.One line is read from the standard input, or from file descriptor FD if the -u option is supplied, and the first word is assigned to the first NAME, the second word to the second NAME, and so on, with leftover words assigned to the last NAME. Only the characters found in $IFS are recognized as word delimiters. If no NAMEs are supplied, the line read is stored in the REPLY variable. If the -r option is given, this signifies `raw' input, and backslash escaping is disabled. The -d option causes read to continue until the first character of DELIM is read, rather than newline. If the -p option is supplied, the string PROMPT is output without a trailing newline before attempting to read. If -a is supplied, the words read are assigned to sequential indices of ARRAY, starting at zero. If -e is supplied and the shell is interactive, readline is used to obtain the line. If -n is supplied with a non-zero NCHARS argument, read returns after NCHARS characters have been read. The -s option causes input coming from a terminal to not be echoed. The -t option causes read to time out and return failure if a complete line of input is not read within TIMEOUT seconds. If the TMOUT variable is set, its value is the default timeout. The return code is zero, unless end-of-file is encountered, read times out, or an invalid file descriptor is supplied as the argument to -u.Causes a function to exit with the return value specified by N. If N is omitted, the return status is that of the last command. -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the 1003.2 standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on by default when the shell is interactive. -P If set, do not follow symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG trap is inherited by shell functions. - Assign any remaining arguments to the positional parameters. The -x and -v options are turned off. Using + rather than - causes these flags to be turned off. The flags can also be used upon invocation of the shell. The current set of flags may be found in $-. The remaining n ARGs are positional parameters and are assigned, in order, to $1, $2, .. $n. If no ARGs are given, all shell variables are printed.For each NAME, remove the corresponding variable or function. Given the `-v', unset will only act on variables. Given the `-f' flag, unset will only act on functions. With neither flag, unset first tries to unset a variable, and if that fails, then tries to unset a function. Some variables cannot be unset; also see readonly.NAMEs are marked for automatic export to the environment of subsequently executed commands. If the -f option is given, the NAMEs refer to functions. If no NAMEs are given, or if `-p' is given, a list of all names that are exported in this shell is printed. An argument of `-n' says to remove the export property from subsequent NAMEs. An argument of `--' disables further option processing.The given NAMEs are marked readonly and the values of these NAMEs may not be changed by subsequent assignment. If the -f option is given, then functions corresponding to the NAMEs are so marked. If no arguments are given, or if `-p' is given, a list of all readonly names is printed. The `-a' option means to treat each NAME as an array variable. An argument of `--' disables further option processing.The positional parameters from $N+1 ... are renamed to $1 ... If N is not given, it is assumed to be 1.Read and execute commands from FILENAME and return. The pathnames in $PATH are used to find the directory containing FILENAME. If any ARGUMENTS are supplied, they become the positional parameters when FILENAME is executed.Suspend the execution of this shell until it receives a SIGCONT signal. The `-f' if specified says not to complain about this being a login shell if it is; just suspend anyway.Exits with a status of 0 (true) or 1 (false) depending on the evaluation of EXPR. Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators as well, and numeric comparison operators. File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically. Other operators: -o OPTION True if the shell option OPTION is enabled. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge. Arithmetic binary operators return true if ARG1 is equal, not-equal, less-than, less-than-or-equal, greater-than, or greater-than-or-equal than ARG2.This is a synonym for the "test" builtin, but the last argument must be a literal `]', to match the opening `['.Print the accumulated user and system times for processes run from the shell.The command ARG is to be read and executed when the shell receives signal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPEC is supplied) or `-', each specified signal is reset to its original value. If ARG is the null string each SIGNAL_SPEC is ignored by the shell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0) the command ARG is executed on exit from the shell. If a SIGNAL_SPEC is DEBUG, ARG is executed after every simple command. If the`-p' option is supplied then the trap commands associated with each SIGNAL_SPEC are displayed. If no arguments are supplied or if only `-p' is given, trap prints the list of commands associated with each signal. Each SIGNAL_SPEC is either a signal name in or a signal number. Signal names are case insensitive and the SIG prefix is optional. `trap -l' prints a list of signal names and their corresponding numbers. Note that a signal can be sent to the shell with "kill -signal $$".For each NAME, indicate how it would be interpreted if used as a command name. If the -t option is used, `type' outputs a single word which is one of `alias', `keyword', `function', `builtin', `file' or `', if NAME is an alias, shell reserved word, shell function, shell builtin, disk file, or unfound, respectively. If the -p flag is used, `type' either returns the name of the disk file that would be executed, or nothing if `type -t NAME' would not return `file'. If the -a flag is used, `type' displays all of the places that contain an executable named `file'. This includes aliases, builtins, and functions, if and only if the -p flag is not also used. The -f flag suppresses shell function lookup. The -P flag forces a PATH search for each NAME, even if it is an alias, builtin, or function, and returns the name of the disk file that would be executed.Ulimit provides control over the resources available to processes started by the shell, on systems that allow such control. If an option is given, it is interpreted as follows: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -c the maximum size of core files created -d the maximum size of a process's data segment -e the maximum scheduling priority (`nice') -f the maximum size of files written by the shell and its children -i the maximum number of pending signals -l the maximum size a process may lock into memory -m the maximum resident set size (has no effect on Linux) -n the maximum number of open file descriptors -p the pipe buffer size -q the maximum number of bytes in POSIX message queues -r the maximum real-time scheduling priority -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locks If LIMIT is given, it is the new value of the specified resource; the special LIMIT values `soft', `hard', and `unlimited' stand for the current soft limit, the current hard limit, and no limit, respectively. Otherwise, the current value of the specified resource is printed. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds, -p, which is in increments of 512 bytes, and -u, which is an unscaled number of processes.The user file-creation mask is set to MODE. If MODE is omitted, or if `-S' is supplied, the current value of the mask is printed. The `-S' option makes the output symbolic; otherwise an octal number is output. If `-p' is supplied, and MODE is omitted, the output is in a form that may be used as input. If MODE begins with a digit, it is interpreted as an octal number, otherwise it is a symbolic mode string like that accepted by chmod(1).Wait for the specified process and report its termination status. If N is not given, all currently active child processes are waited for, and the return code is zero. N may be a process ID or a job specification; if a job spec is given, all processes in the job's pipeline are waited for.The `for' loop executes a sequence of commands for each member in a list of items. If `in WORDS ...;' is not present, then `in "$@"' is assumed. For each element in WORDS, NAME is set to that element, and the COMMANDS are executed.Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) done EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression is omitted, it behaves as if it evaluates to 1.The WORDS are expanded, generating a list of words. The set of expanded words is printed on the standard error, each preceded by a number. If `in WORDS' is not present, `in "$@"' is assumed. The PS3 prompt is then displayed and a line read from the standard input. If the line consists of the number corresponding to one of the displayed words, then NAME is set to that word. If the line is empty, WORDS and the prompt are redisplayed. If EOF is read, the command completes. Any other value read causes NAME to be set to null. The line read is saved in the variable REPLY. COMMANDS are executed after each selection until a break command is executed.Execute PIPELINE and print a summary of the real time, user CPU time, and system CPU time spent executing PIPELINE when it terminates. The return status is the return status of PIPELINE. The `-p' option prints the timing summary in a slightly different format. This uses the value of the TIMEFORMAT variable as the output format.Selectively execute COMMANDS based upon WORD matching PATTERN. The `|' is used to separate multiple patterns.The `if COMMANDS' list is executed. If its exit status is zero, then the `then COMMANDS' list is executed. Otherwise, each `elif COMMANDS' list is executed in turn, and if its exit status is zero, the corresponding `then COMMANDS' list is executed and the if command completes. Otherwise, the `else COMMANDS' list is executed, if present. The exit status of the entire construct is the exit status of the last command executed, or zero if no condition tested true.Expand and execute COMMANDS as long as the final command in the `while' COMMANDS has an exit status of zero.Expand and execute COMMANDS as long as the final command in the `until' COMMANDS has an exit status which is not zero.Create a simple command invoked by NAME which runs COMMANDS. Arguments on the command line along with NAME are passed to the function as $0 .. $n.Run a set of commands in a group. This is one way to redirect an entire set of commands.Equivalent to the JOB_SPEC argument to the `fg' command. Resume a stopped or background job. JOB_SPEC can specify either a job name or a job number. Following JOB_SPEC with a `&' places the job in the background, as if the job specification had been supplied as an argument to `bg'.The EXPRESSION is evaluated according to the rules for arithmetic evaluation. Equivalent to "let EXPRESSION".Returns a status of 0 or 1 depending on the evaluation of the conditional expression EXPRESSION. Expressions are composed of the same primaries used by the `test' builtin, and may be combined using the following operators ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else false When the `==' and `!=' operators are used, the string to the right of the operator is used as a pattern and pattern matching is performed. The && and || operators do not evaluate EXPR2 if EXPR1 is sufficient to determine the expression's value.BASH_VERSION Version information for this Bash. CDPATH A colon-separated list of directories to search for directries given as arguments to `cd'. GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion. HISTFILE The name of the file where your command history is stored. HISTFILESIZE The maximum number of lines this file can contain. HISTSIZE The maximum number of history lines that a running shell can access. HOME The complete pathname to your login directory. HOSTNAME The name of the current host. HOSTTYPE The type of CPU this version of Bash is running under. IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input. MACHTYPE A string describing the current system Bash is running on. MAILCHECK How often, in seconds, Bash checks for new mail. MAILPATH A colon-separated list of filenames which Bash checks for new mail. OSTYPE The version of Unix this version of Bash is running on. PATH A colon-separated list of directories to search when looking for commands. PROMPT_COMMAND A command to be executed before the printing of each primary prompt. PS1 The primary prompt string. PS2 The secondary prompt string. PWD The full pathname of the current directory. SHELLOPTS A colon-separated list of enabled shell options. TERM The name of the current terminal type. TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word. auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job. histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'. HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list. Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, exchanges the top two directories. +N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top. -N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with zero) is at the top. -n suppress the normal change of directory when adding directories to the stack, so only the stack is manipulated. dir adds DIR to the directory stack at the top, making it the new current working directory. You can see the directory stack with the `dirs' command.Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and cd's to the new top directory. +N removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second. -N removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last. -n suppress the normal change of directory when removing directories from the stack, so only the stack is manipulated. You can see the directory stack with the `dirs' command.Display the list of currently remembered directories. Directories find their way onto the list with the `pushd' command; you can get back up through the list with the `popd' command. The -l flag specifies that `dirs' should not print shorthand versions of directories which are relative to your home directory. This means that `~/bin' might be displayed as `/homes/bfox/bin'. The -v flag causes `dirs' to print the directory stack with one entry per line, prepending the directory name with its position in the stack. The -p flag does the same thing, but the stack position is not prepended. The -c flag clears the directory stack by deleting all of the elements. +N displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero. -N displays the Nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero.Toggle the values of variables controlling optional behavior. The -s flag means to enable (set) each OPTNAME; the -u flag unsets each OPTNAME. The -q flag suppresses output; the exit status indicates whether each OPTNAME is set or unset. The -o option restricts the OPTNAMEs to those defined for use with `set -o'. With no options, or with the -p option, a list of all settable options is displayed, with an indication of whether or not each is set.printf formats and prints ARGUMENTS under control of the FORMAT. FORMAT is a character string which contains three types of objects: plain characters, which are simply copied to standard output, character escape sequences which are converted and copied to the standard output, and format specifications, each of which causes printing of the next successive argument. In addition to the standard printf(1) formats, %b means to expand backslash escape sequences in the corresponding argument, and %q means to quote the argument in a way that can be reused as shell input. If the -v option is supplied, the output is placed into the value of the shell variable VAR rather than being sent to the standard output.For each NAME, specify how arguments are to be completed. If the -p option is supplied, or if no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. The -r option removes a completion specification for each NAME, or, if no NAMEs are supplied, all completion specifications.Display the possible completions depending on the options. Intended to be used from within a shell function generating possible completions. If the optional WORD argument is supplied, matches against WORD are generated.H ܻ P h  @  L $  I  8  e      h      P , X l  H @   <  \  t#|'-/11256h7X99H::D;t<<?hJMtPPT4V YZalias `%s': invalid alias namebind_builtinlvpVPsSf:q:u:m:r:x:`%s': invalid keymap name%s: cannot read: %s`%s': unknown function name%s is not bound to any keys. %s can be invoked via , "%s"%s`%s': cannot unbindX   P   H                8      0              only meaningful in a `for', `while', or `until' looploop countNULL%s %s %s LPOLDPWD=chdirHOME not setOLDPWD not setCDPATHpvVcommand_builtin%s: error retrieving current directory: %s: %s `%s': not a pid or valid job spec%s: invalid signal specification%s: usage: %s: ambiguous job specwrite error: %s%s: not a shell builtin%s: restricted%s: no job control%s: no such job%s: %s out of rangeSIGJUNKUnknown%2d) %s%s: invalid number%s: invalid option name%s: not found%s: numeric argument required`'+afiprtxF%s %d %s cannot use `-f' to make functions%s: cannot destroy array variables in this waycan only be used in a function/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ s/ / s/ s/ s/ s/ / s/ s/ / s/ s/ s/ s/ s/ s/ / s/ / s/ / s/ s/ s/ / neEadnpsf:enable %s enable -n %s %s: not dynamically loaded%s: cannot delete: %scannot open shared object %s: %scannot find %s in shared object %s: %s< ; ; < ; < ; ; ; ; ; ; ; ; ; ; ; ; ; %s: not a regular file%s: file is too large_evalfileparse_and_execute_toppe_disposeparse_and_executecla:%s: cannot execute: %s~/.bash_logoutThere are stopped jobs. not login shell: use `exit'exit logout :e:lnrsno command foundhistory specificationbash-fc%s: cannot open temp file: %s %c%s %s${FCEDIT:-${EDITOR:-vi}}${FCEDIT:-${EDITOR:-ed}}fc builtinY rY rY rY rY rY rY Y rY Y rY rY rY Y Y currentjob %d started without job control%4d %s builtin hash -p %s %s hashing disableddlp:rt-thits command%s: hash table empty %s 8f e e e e e e e (f e e e f e f e f %s: %s %s: cannot open: %s%*s%s These shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. Shell commands matching keywords `Shell commands matching keyword `no help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.acd:npsrw%s: history expansion failedhistory position%5d%c %s%s cannot use more than one of -anrwp )p p p )p )p )p )p )p )p )p )p )p p )p xp )p hp Xp )p )p )p Pp ahrlpnxrsjobs_builtinno other options allowed with `-x'y x py x `y x Py 8y x x x x  y Unknown error(%ld) - %s%s: arguments must be process or job IDsdirstackdirectory stack emptydirectory stack index %2d %sno other directory%s: invalid timeout specification%s: invalid file descriptor specification%d: invalid file descriptor: %sersa:d:n:p:t:u:read_builtinread error: %d: %s@ y y (  y y y y y y y y  y  y   @  can only `return' from a function or sourced scriptfv%s: cannot unset%s: cannot unset: readonly %s%s: not an array variableSHELLOPTS%-15s %s set %co %s allexportbraceexpanderrexiterrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalpipefailprivilegedxtraceoffcannot simultaneously unset a function and a variableYMldeclare -%s %s -%s afnp%s: not a function-rashift countfilename argument required%s: file not foundcannot suspendcannot suspend a login shellunknowntrap -- %s %d trap -- %s %s   |            ^     ^ ^ ^ %s is aliased to `%s' alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is %s %s is hashed (%s) -type-path-allafptP                                    x (%s, -%c) (-%c) %-20s %16sunlimited%s: cannot get limit: %s`%c': bad commandhardsoft%s: cannot modify limit: %score file sizeblocksdata seg sizekbytesscheduling prioritypending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuesreal-time prioritystack sizecpu timesecondsmax user processesvirtual memoryfile lockscTocodjoxoe ofYocoi oloxomoxonopooq ooros pxotp pu(pv ;pxox Jpagourwxu=%s,g=%s,o=%s Spoctal number -Sumask%s %04lo `%c': invalid symbolic mode operator`%c': invalid symbolic mode characterOPTARG%s: invalid shell option name-u-sshopt %s %s psuoqcdable_varscdspellcheckhashcheckwinsizecmdhistcompat31dotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoregnu_errfmthistappendhistreedithistverifyhostcompletehuponexitinteractive_commentslithistlogin_shellmailwarnno_empty_cmd_completionnocaseglobnocasematchnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echocannot set and unset shell options simultaneously   p  p  rHr +rHrBr0r -p r4GrHrrr(rrBrL ssxH#sH.stH9sH FsPs esHms- ysCsHs?sxsCsss( sHss$+YMlmissing hex digit for \xwarning: %s: %s#'-+ 0v:hjlLtzlld f f f f  f f f f f f f f         f f f f f f f  f f f f f h f f f f f f f f f f f f f f f f f f f f f f  f f f f    f h  f f f f f f f  f f f  f  f  f  v    v v v                          v    v v v          -  ]      `%s': missing format character%s: illegal option -- %c %s: option requires an argument -- %c -r%s: invalid action namecomplete bashdefault-o %s dirnamesfilenamesnospaceplusdirs-a-b-d-f-g-j-k-varrayvar-A %s enabledhelptopicrunningsetoptsignalstopped-G%s %s -W-P-X-F-Cgroupserviceuserabcdefgjko:prsuvA:G:W:P:S:X:F:C:warning: -F option may not work as you expectwarning: -C option may not work as you expect%s: no completion specification                                                        p ` P @ 0                    ` P   @ 0 y y#y,y6y>y@ a_ySdbecf  de@oykecflwyk  yg`@jkkyysy4 yy y@u8 vBASH_REMATCH/dev/fd//dev/std%s: bad network path specificationsocketconnect%ldm%d.%03dssh_makepathsh_realpathTMPDIR/var/tmp/usr/tmpshtmp%s/%s-%luw+0Y 0Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y 0Y 0Y 0Y  Y 0Y Y 0Y 0Y 0Y 0Y 0Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y 0Y 0Y Y 0Y 0Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y 0Y 0Y 0Y 0Y Y 0Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y 0Y 0Y 0Y X @Z @Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z @Z @Z @Z Z @Z  Z @Z @Z @Z @Z @Z  Z @Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z @Z @Z  Z @Z @Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z @Z @Z @Z @Z  Z @Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z  Z @Z @Z @Z ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] x] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] x]  _ ^ ^ ^ ^  _ ^ ^ ^ ^ ^ ^ ^ ^ g` ` ` ` ` ` ` ` ^ ^ ^ ^ ^ ^ ^  _ ^ ^ ^ ^ ^ _ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ 0_ ^ ^ ^ ^ 6_ ` ` ^ _ z_ ^ ^ ^ ^ ^ ^ ^ i_ ^ ^ ^ X_ ^ G_ ^ ` ^ _ %s/cur%s/tmp%s/new%s/%s%s/invalid base0123456789ABCDEF0123456789abcdefOAOBOCODOHOF5.1 l|h^0%bB l|hwW^0bB l|h^0bB hl^$0ftFT;,%wbeWBE|_*\AaIiCcDdPpYyRrSsXx~pabortaccept-linearrow-key-prefixbackward-bytebackward-charbackward-kill-linebackward-kill-wordbeginning-of-historybeginning-of-linecall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-search-historyhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-regionmenu-completenext-historyoverwrite-modepossible-completionsprevious-historyquoted-insertre-read-init-fileredraw-current-linereverse-search-historyrevert-lineself-insertstart-kbd-macrotab-inserttranspose-charstranspose-wordstty-statusundouniversal-argumentunix-filename-ruboutunix-line-discardunix-word-ruboutupcase-wordyankyank-last-argyank-nth-argyank-popvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-ruboutvi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-yank-argvi-yank-tonon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-again{ `  DŽP Մ   `    ` 0 D T0 e  op  Ђ   Ņ م@ p   # 2 ># M ` n@ }    ˆ` ؆2 г    -P @  PP  \0 j` ` $@ L | w `  p P ̇P  2 `  Ы   ֊0y * : J@{ U Z@ mЃ p   ~ } Ĉp~ ш~ ڈ     0 ( 7 F S0 b l x    p   ʉ ӉЪ      0 ) 2 C P ^ s ` P  Г    ʊ ӊШ @ 0 --More--// "\'`@$><=;|&{(Display all %d possibilities? (y or n) readline: bad value %d for what_to_do in rl_complete noneaudiblevisible"%s%s": "%s" %s%s outputs %s readline: %s: line %d: %s readline: %s $endif without matching $if\C-%cblink-matching-parenprefer-visible-bellterm=mode=# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on ... C-\M-unknown parser directiveno closing `"' in key bindingprefix-metaINPUTRC~/.inputrc/etc/inputrcbell-stylecompletion-query-itemsisearch-terminatorskeymapset %s %s %s is set to `%s' Control-C-CTRL-Metaotherbind-tty-special-charsbyte-orientedconvert-metadisable-completionenable-keypadexpand-tildehistory-preserve-pointhorizontal-scroll-modeinput-metamark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmeta-flagoutput-metapage-completionsshow-all-if-ambiguousshow-all-if-unmodifiedvisible-statsemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insertendifincludeDELESCEscapeLFDNewlineRETReturnRuboutSPCSpaceTab$else found without matching $ifprint-completions-horizontally        4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4  4 4 4 4   4 p X @ 4 4 4 4 4 4 4 ( 4 4 4  4  4  4 x 8? \J$1PJDJRx3_x?v/00h3ؒ00dJ`3(d3?l3p `    0  ;&|$"'`bad word specifierevent not foundsubstitution failedunrecognized history modifierno previous substitutionunknown expansion error:$*%^ = ;&()|<>H  X h 8 }                                                               Q   5        %   }       ~ ~ h h h h h h h h   h h h h h h h h h h h h h h h h h h h   h h h h h h h h h h h h h h h h h h h h h h h h h h    x 0 0 0 0 0 0 0 0 ` x 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ` x 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0   P ?*+@!asciialnumalphablankcntrlgraphlowerpunctupperxdigitNULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzerotwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracket> C B B B B B B nB XB BB ,B B A A F mD mD mD mD mD mD mD mD @E @E mD mD mD mD mD mD mD mD mD mD mD mD mD mD mD mD mD mD mD D D ^Y W W W W W W W W X X W W W W W W W W W W W W W W W W W W W W W  $p * 0?*+@!asciiwordalnumNULSOHSTXETXEOTENQACKalertBSbackspaceHTLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL;P5h5555455D6d(6D6T\6T"|6$6d$64&6$'6+7,474@`7@x7TA7B7dE7tE7E8E8E48FL8dFd8F|8G8H8I84I8I9I9DJ09JH9dKh9K9dL9L9M9DN9N:N(:4O@:OX:DRx:R:S:T:TU:tU;U;TW<;X\;Y;d;te;k;v;dw<Dy<<\<Dt<4<<<<4=$=D=\=|=T====>$>4@>X>|>>>>T>?44?tP?h??$???T?d@(@dH@dh@@@@D@A(AdDA`AxADAAAAdB(BLBtpBBBdBBC0CTTClCCC$CC4Dd(DDD\DT|DtDDD$DtEE$8ETTEpEEE4EEEF8FTFtF4FdFFFGd(GDGTdGG4GGG HT H 0H$ LH lH Hd H H HIIT8ITItI$ITIIIIJ8JXJxJ J J$J$Jd%KD(4KT>TK$?tKGKIKPKPKTRLa4LdTLdktLtkLkLkLkLkLlMTlMtl4MlLMllMlMmMTmMdmMmMnNnNDn4NTnLNolNDoNoN4pNTpNpNq Oq(O4rDOtr\OrtOrO4sOsOsODtOtPt,PuDPDu\PdutPuPTvPvPvPwPxQy4QTyTQztQ4{Q{Q$|Q|Q$}R}0R}PR~hRt~R~R4RtRRS,SDS\StSSSSSTă T8TXTTxTTDTTTT4UUh>h>h?h$?htCiC iD}$>}$?}A}dA}B~C<~C\~D|~F~F~4G~TG~GdH H8HPIhJKKLMN O$DO<tOTtPx$TUUЀWZ[84]\_|__`́bbDctc0ddPdldteej؂kTk k$lDDmdnnnă$opptq<qX4sxsttԄTuuv0wTDxttxt{$|Ѕ|T}}0~PĀtd؆d8Xdxdtԉ؇Ԍ0HldȈd ,LTl$Љԣ$D4dLtd|TtԊ04LtdDįԯЋ԰$$dD\|tԵԌ40tPĺpDЍdT0HdhD̎4$Dh$dԏD4T4tdؐdt<\4|ܑD(LhTTȒD84Xt$Tؓ$0LlTtДD(HdhT 4 ЕT  @`Ԗ,Dd4|$ܗ($++<+T+pd,,-И../(4/@T/Xt/p0001ؙT122843X3x34$5Ԛt67T88$:X:xT<TCL؛dMMM,NDdN\O|tPPP̜$QTQQTR8tRPRhDSSTȝUV\(4]@]\^x_4ataԞbcd4fTDjtTjdjmȟdmtmmm,$nLTndn4otooРo$pDq$TrDr\stDstvġ4www4x0xLxdyy4ztz̢}}~T~4~L~d|Tdȣĉ$4Tt4Ȥ$t ԣ8$Xħ|T̥d,PpDئD4Xxdtԧdd8PtpD̨D4TtTԩ$4TtD$tԪT0Pp t $ ȫT 8Ph$ȬT (T#H$l$&,/̭/14($4@4`8t999Ȯ9:D:;4;LЯDACC0DTElEdF$ḬZ[]$^<a\e|hppرTttTu0vPwp$wTwwwвxTxxTy8tyPyh$ztz{ijD{ܳ{{ {${<{X$|p}}~Դ D8Xx4dеĊ(TLċdTĖ @dԚ4ěܷTT4PlȸԡDT(t@\ԣxй4 D@TXĪxDīTкd0dPp4л40Ptt$̼Td$,$D4`dxt̽(@4X4x44оd0Pt4TĿܿD d$<TlD4TPh4 @dD4t<\|TT4 $(D$\dxD$8PhDTD(TH`x4t(HhD  D 4d L d |t $0H`$xD4$tHDl4$#T$%%(d&H)h.$1142D59$dTBdBtBBdCCCC0DDLTElEEEE$FFGtG44HPHpHJLNtPP P8TQPQhQTRUUDWdYY<[\D\t\4adbtdde(De@ede|$fTffDntpp$Tq<qTqpsttuvTvdw dx@`$d$$D 8PąhTԆT$(H`$xDď$,LlԖd 48TlTtt4Lh4d4 @`D|T44tPh4Ltp$dT8$Tpd4t0Hld,tH`Txd4 $<Ttdt40P$hTD4DLd|d$(H`dtd(@XTp44,dLdltdT $ <T \D |$ D $0Pt48XptDd4Ld| D $!!!$"<d"T#p%D%d%%%4& t&$$(@(\)tD)t))$*4*D*t* *8*P*h+D+,t,,,- t-@$.`..D//d002<2T4t6689T;4@0dMPXpXD[d[[]` D`8Tb\tbtbbTcDdde4fT4gthidknnp0dqHq`ruv}$T0$PpĆ444TxT4Tt| hAB I8LAB P AB h6AB 0pAG RAB L@AB `AB DRAB  PAB AG,PAB GHZAB Dd`AB F0AB D uAB C KAB ACF(?D  F AB D0CAB (AB DDPKAB SdAB D` AG pFB ,GB A,FB AH AFB `#AB ,AG D:LB A`!GB x!AG 0SAB EAB AB @KAB AB E`.AB 0AB DL`_AB FlAB AAB D@kAB D2AB 2AB 0oAB AB F(@AAB DD,AB FdAB DAB DPAB pOAG AB EPAB F AB FEE0 AB IPAB DlpLAB FP AB F$HAG YK`%AB F@'$AB I KAAB $@LAB LD0RSAB D`RSAB D|RAB SAB C0UAB FWAB IsFAB  sAB F,u1AB DPuQAB \uXAB AxvoAB vrAB F xAB FIFxqAB D0yAB   yAB FIF, zAB EL {AB Fl |AB D }AB FF P~SAB D ~|AB E 04AB D p#AB  <AB 0 ?AB DL AB IFl (AB  ]AB D PAG F `[AB  AB FI `AB E `AB E8 AB FX AB Fx AB PF @|AB NE 2AB FI ]AB D `?AB D ;AB ( UAB DD @SAB Pd 8AB D 0AB  BAB FF `BAB FF NAB FFF jAB IFF p*AB  8 ZAB IFF \ ZAB IFF `HAB FFF AB FFF MAB  ЎqAB FFFPKAB RAB  4AB LFFX=AB MIx AB FeAB I0#AB C`$AB D6AB  ЖtAB F,PAB DpAB \dAB tAB F CAB ACp0AB wAB A .AB DP3AB D  AB 81AB DT1AB Dp0lAB A>AB AAB FHAB C>AG DAB BF$kAB A@0)AB X`AB FxAB FAB EAB F`MAB DAB EPiAB FI4iAB FI T0_AB IFFx+AB KAB E5AB PYAG mAB D aAB FNAB D8AB EX`MAB FIx>AB DAB DkFB AB FP'AB AMAB E$оFAB NED &AB D`PZAB x'AB D#AB AB IEAB DAB BC*AB O( AB IH#AB `'AB AGAB FEcAB I `AB ACI@ AB IPAB E$ {AB CDUAB BFdAB CqAB EAB FPAB FAB BCAB C$`AB <pAB TAB lAB AB 2AB 2AD PAB pAG EAB KF AB 4-AB AP5AB AlP AB `PAB PAB  AB &AB @ AB PAB F?AB 4@iAB LyAB LIl0AB PGAB DRAB DAB DuAB D0 9AB  p /AB $ /AB < QAB E\0!AB Dx!/AD !CAB @"vAB D" AB ".AB #)AB  @#AB $`#%AB <#AB E\P$FAB t$FB $-AB E%AB F&9AB 'IAB PP'rAB F$(XAB ND0)AB Fd)lAB AF *lAB E*AB D +YAB E+BAB J+"AB ,oAB FH8p,PAB DT,kAB Et0-4AB Dp-/AB D- AG - AG - AG - AG  -AD $-AB ED.%AB D`. AG x.AD /AB F0AB FF1#AB 1AB F3EAB F(P4XAB DD4AB D`@5 AB xP5AB F7AB 07yAB D7AB F:AB FI P;AB FFF0 `<-AB DL <AB Fl ?$AB  ?MAB IEE @=AD  P@AB II BAB JEE!CAB D !pDyAB DAB D"pMGAB "MRAB " N_AB #NAB F(#OAB FFH#@P5AB `#P AB x#PAB E#pQNAB FF#QHAB #RAB D#R_AB E $0SAB D($SBAB DD$ TAB D`$TpAB AF$VAB E$X)AB $0Xl AB F$dGAB $dbAB MF%`eAB Q0%e,AB H%fOAB MIh%`f@AB D%fEAB FF%fEAB FF%@gBAB %gAB C%iAB F& k"AB 4&Pk AB DP&pkAB Sp&lAB PF&lIAD AF&m`AD AG &`mAB FFF&m#AB  ' nuAB F,'qjAB SL'r7AD d'PrAB D'Ps_AD IF'sAB 'PtjAB E'uAB FE'pvgAB D(vJAG ,(0wQAD D(w_AG \(w3AB t(0x3AB (px<AB (x.AB (xAB D(pyAB D( z#AB A)PzAB AF0){AB FP)1AB h) AB B)AG B) AB F)AB F)АFAB * AB F *^AB F@*`pAB E`*ГpAB F*@%AB F*pAB F*7AB B*07AB B+p7AB B +AB B@+@AB B`+ЗIHB x+ AB +SJB +pAB B+ AB D+FB +AB ,Л*FB ,,"GB D,0AB BCd,AB AC,P5KD ,AB ,%AG ,Н9AB A, AG - AB -@.AB 0-pAB H-@DAB `-DAB  x-AB ACI-AB D-`AB  -AB ACI-AB I.pAB I 4. AB ACIX. AB Ox.ХOAB A. WAB .AB C. 5AB .`AH .AB I/ AB FAB 0AG AD1AB ,1AB DH1@pAB `1AB D|1&AB 1AB LF1XAB I1AB E1AD  2RAB $2@AB ID2=AB Id2 CAB I2pAB I2 YAB I2%AB D2"AB D2%AB D3!AB I83@WAB P37AB h3AB 3 FB 3 CAB I3p=AD 3ZAB A3ZAB A4pAD  4 AG 84=AB AT4cAB Et4@AB E4 [AB FF4AB AC4hAB A 4AB FFF 5p-AB HEE852AB AGX5NAB ADx50AB F5AB F5pAB 5*AB A5AB F 6`AB E,6DAB I L6@\AB ACCp6 AB C6@ 9AB HE6 AB `6AB F6|AB F70AB D,7@AB BFL7LAB Fl7@AB BF7PIAB F7AB F7GAB F7AB AG 8SAB AG,8p AB FL8!YAB BFl8"%AB E8$cAB F 8'AB UFH8@*dAB F8.?AD  9.\AB ACF,9P/VAB LL9/VAB Ll90VAB L9p0AB AG94AB BC9`7AB F9>'AB :@>/AG :p>/AG 4:>AB FT:@AAB Ft:EAB F:GAB AG:K[AB F:0QAB AG:0TAB F;VAG ,;0VrAB FL;YAD d;YAG |;Y"AG ; Z,AB I;PqAB F;`yAG ;yAG <yAG <yoAB A8<0z7AB AGX<p|AB B x<|5AB HEE<0AD <PLAD <\AD O<AB HE =^AB O,=AB CL=!AB Il=E AB I =IAB FHE=0aAB D=AB D=PAB O>AB FF(>!AB DD>0]AB Qd>pAB D>!AB >0+AB  >`AB FIF>`AD >*AD A?;AD C$?uAB FD?p!AB D`?AB F?P{AB E?нAB FI?AB F?пAB FI@VAB F @AAB A<@`AB E\@vAB Ax@AB I@`RAB F@YAB D@ AB F@AB  A AB P,A%AB DAAB \AAB tAAB A0AB APAB ApAB A+AB DAAG BPAG  B1AB 8BPAB AFXBAG pB AG B0|AB GLB4AB DBAB DBAB DBAB aCAG 4C>AB DPC0%FB hC`cAD CBAB D C AB FFFCAB CAB CAB D0-AB  D`>AB 8DAB IXDAB FIxDpAB DPMAB FD1FB D4HB D JHB DpAB EOAB X0EAB DLEsAB DhEPBAB FFE.AB DEKAB E eAB FEIAB DE,AB FAB F0FCAB EPF0zAB hFAB DF?AB DF@AB DF5AB DFPAB FpAAB D GAAB D(GIAB DDG`5AB D`G-AB xG^AB LFG0#AB G`"GB G9AB GAB EHAB HgAB E8H AG PH AB FpH AB FHTAB DH`AB FHAB FHAD E I#AB F,IAB FLIAB dIjAB LII0AB IP!AB IAB DI`(AB IAB JRAB JAB A4J8FB LJAB HlJ>AB IJAB J%AB J/AB J0AB J@)AB  KpAB IHE(KpAB  @K  AB FIIdK AB D K AB JEEK 4AB FZ K  AB FII K EAB FII L0 AB F,L gAB DHL aAB DdL AB |L AB L AB L fAB L@ ,AB DLp AB QM` 5AB AM DAB 4M qAB DPMp 9AB hM AB FM BAB DM 1AB MP +AB M nAB FM GAB FN@ AB FO 4N aAB IGGXN 6AB DtN ]AB EN  AB FIN #AB N qAB FINp 6AB DO }AB F (O0! vAB MFFLO! AB FLlO" "AB O" dAB DOP# AB AGO# AB BF O$ fAB FFFP% KAB F$P@& 'AD D@Pp& AB F`Pp) AB OP * AB OP* AB FIPP+ qAB FIP+  AB O Q, AB LFH$Q. AB E DQ`/ AB FFFhQ0 AB BCQ0 OAB BFQ1 fAB FQ`3 AB FIQ4 AB FFR4 AB OF(R`5 AB BIHR`6 AB FIhRp7 UAB LR7 AB ]R8 AB FRR: AB R: AB  R: AB FPES; AB EAB  Vp\ AB FFF8V@] 2AB PV] @AB hV] AD V] AB FV^ 9AB V^ KAB DV _ :AB ADV`a AG  Wa _AB E,Wa AG DWb hAB D `Wpb YAB ACCWc 7AB FWe AB EW0f [AB DWf AB EXpg AAB F Xh uAB F@X@i 2 AB F`Xs }AB FIXv ]AB EX`w AB EXPz EAB IX~ GAB X~ pAB FY` AB 0Y zAB DLY <AB dY@ 5AB |Y ,AB Y |AB FY0 YAB FY ZAB F Y AB FFFZ \AB D4Z 8AB AGTZ 7GB lZ` AG Z nAB PIZ NAB FIZ@ NAB FIZ NAB FI[ NAB FI$[0 NAB FID[ NAB FI d[Б AB KII[` AB F[` AB S [ {AB FFF[p VAB P \Ж VAB P,\0 VAB PL\ VAB Pl\ AB S\ IAB \И oAB D\@ ?AB  \ {AB NEI\ AB A ] AB FII<]P AB DX] \AB Ix]P 9AB ] 9AB ]М jAB II]@ ^AB F] AB KI^0 IAB D$^ KAG <^Ч "AD T^ AD l^ 'AB A^P LAB B^ AB ^ RAB F^ cAB D^ iAB BF _ JAB FFF@_P AB F`_ AB F_p AB F_ =AB _ yAB FI_@ AB F_в AB E`` AB 0`P ~AB DL`д AB Dh` @AB `0 AB D`P pAB D` HAB ` wAB B` lAB FE a AB FEE4a AB ITaп AB la AB a AB AJa gAB ACa AG a AG a UAB Tb AB ,b0 _AB FLb AB Elb AB BFb AB Ib RAB FLb {AB Fb  AB c  AB D c AB F@c` AB F`c AB Fc AB Fc AB Fc AG c AG c0 AG dP AG  dp =AB F@d AG Xd AD pd AG d DAB PdP :AB Fd AAB Pd AAB Pe0 LAB P(e PAB IFHe AB Fhe MAB Ae NAB BF ep 9AB ACFe AB FFeP AB Ff \AB FF(f AB BCHfP AB FhfP 2 AB I f AB FFFf` IB f 9AB f 8AB f YAB  g` aAB F,g AB DHgp  AB `g bAG D|g #AB g !AB gP +AB  g AB FFFgP AB hp ;AB h AB II8h@ jAB FIXh AB AFxh yAB FHh AB Fh AB BIh KAB h0 AB D i AB D(i tAB LHi AB Shi0 2AB Aip AB FLi AB AFi AB FLi AB AGj zAB KI$j@ AD  AB I C AB FFFD AB DЁE UAB F G rAB IFEG 8AB I4H >AB FTI AB l0I AB FII "AB I \AB FĂPJ AB FPL EAB DL 6AB DL )AB D8M vAB EXM GAG FxN AB FO nAB E@P AB F؃PQ AD pQ 0AB D Q .AB D(Q AB FHR  AB `R AB FS AD K0T BAD T AB ЄT AB F@U  AB PU mAB I(X yAB @@Y AB E`Y AB FPZ AB FZ vAB E`[ AB E[ pAB E`\ FAB B \ uAB FI@0^ AB FI`a AB Fb AB Fc AB U0i AB Fk AB F o AB FQF$pp xAB IDp AB \q rAB AG| r 0FB Pr FB `r AG ć s AG ܇s ?AB  t AB D0u &AB (`w  AB @pw ,AB  Xw 'AB FIF|{ 'AB  |  AB IEE} AB E؈~ AB ~ WAB 0 AB E(0 AB DD0 AB D` iAB F0 'AD ` -AB  AB ȉ .AB  AB F AB ADG$ UAB FD 4AG \0 AB tP UAG  \AB  .HB @ AB Ԋ` DAB  +HB  AB  AB 4 AB L AB Fl IAB DЋ lAB IE@ 4AB Aċ zAB FE CAB DP eAB  MAB 0  AB FP0 oAB h dAB  jAB D AB  LAB DЌ AB E Г AB FFFД AB AD4 AB L@ uAG FSl aAB F0 AB F mAB F̍p dAB FF AB FF AB FF, 3AD DP AB \P AB F|0 AB E AB F @AB D؎ AB D 7AB  2AB D(` AB EH FAB `@ AB N AB  MAB Ш LAB D̏ AB D dAB  GAB Ъ hAB 0@ BAB H  AB ` AB FP AB D WAB D@ AB AGؐ YAB EP 1AB  UAB ( :AB DD0 AB  \б AB HEEp bAB  AB BF AB Jؑ AB J AD K 0AB 0 0AB H@ 8AB Ad MAB IEз AB AF {AB FFĒ 9AB AD@ AD ` AD  HB , TAB ACLp ?AD d BAB AC AD  nAB FFE AB I  AB  'AB  'AB ( lAB @ AB D\@ AB I| AAB 0 `AB FI ?AB E Ԕ AB FIE p AB FFJ @ YAB IRE@ AB A\0 AB F| )AB FP AB A AB ACؕ oAB AF` AB F AB F8 JAB FX AB BFx cAB B0  AB D@ 5AB IԖ AB F ,AB F@  AB F4P AB L` AB dp vFB | gAB ` 3AB D AB ȗ "AB  GAD D@ AB FP ;FB 4 AB L  AG d ,FB | #LB  [AB D AB D̘ SAB p AB D0 QAB E %AB 8 AB CX AB MHx AB FI AB AGp AJ Й JAB  mAB P ^AB  >AB 0 ZAB E PP GAB ACFt AB  }AB F@ AB E̚` RAB F .AB F KAB $@ `AB D@ AD AG`0 *AG E`  AB Fp oAB E )AB ؛ )AB  @ rAD FFF #AB , -AB D  +AB \P +AB t AB F@ $AB Cp sAD SԜ ^AB P <AB  5AB D  AB A<! AB F\p" @AB F|# JAB $ DAB DP$ AB ACН`% AB HH`& 6AB F. sAB I0 / >AB DL`/ AB Dh 0 AB F2 AB  2 AB @2 [FB О2 >AB 2 /AB 3 FB 3 LLB 04 6AB HP4 qAB Eh4 wAB P5 AB KI 6 RAB 6 AB L؟7 AB E8 AB 8 3AB ( 9 AB DD9 "AB Ed: TAB AG@< qAB F= %AB FĠ@ #AD ܠ A kAB EB wAB KID AB 4D AB FTF AB DpG sAB E`I AB I[ AB FСq +AB 0q SAB Gr %AB  r AB ~II @s `AB IEEds kAB |Pv  AB pv 3AB v AB H̢pw AB w  AB w /AB Dw AB 0w AB Hx AB `0x /AB D|`x /AB Dx AB x rAB FУ0y UAB Fz YAB FLz KAB D,@{ AB DP{ dAB \{  AB t{ SAB D0| PAB D| AD Ĥ|  AB BF} AB Dp~ AD ~ IAB 0~ AB QP AB FMp xAB LJ AB HEI #AB ̥Ђ #AB   AD   WAB FFF p VAB 8Ѓ 2AB FX AB Fx =AB ` wAB D oAB DȦP GAB KI yAB D AB D GFB  8 AB ACF\ EAB Dx` GAB  qAB E0 9AB ȧp 5AB  5AB  AB FFF AB FI< HAB BF\` 3AB t )AB Ў  AB  AB EĨ \AB ܨ AB Dp fAB  lAB (P rAB DDБ AB \` LB t dLB  LB  AG 0 LB ԩ AB  AD  AB E $ AB NHIH` .AB Dd AB I AB D AB Fp AB F0 AB C AB  'AB 0P IAB H >AB ` AB F /AB D !AB @ lAB ̫ BAB  3AB @ }AG  AB , }AB EL` AB d +AB | kAB FI AB D AB BFج AB F )AB Щ AB FF0`  AB Hp NAB ` %AB x lLB ` AD  FB  AD ح AG Ы -GB  IAB  P [AB 8 sAB P0 AB F p AB FFE QAB  (AB Į0 QAB ܮ AB E` AB FF`  AB 4p  AB L EAB Elг AB D` AB  <AB DP GAB ԯ >AB  jAB FI P AB F,@ AB E L AB FFFp@ MAB E .FB  .FB  -AB F AD F ?AB KFF$ AB ED AAB D` AB C AG  AG  AG ȱ0 ^AB F AB F \AB  AB 8 bAB IXp RAB Dt "AB  AB F &HB IJ@ AB E` -AB  %AD   AB , +FB D 1AB \@ WAB Dx yAB O jAB I >AB DԳ %AB  YAB ` FAB D RAB E@ "AB D\@ AB t` (AB  <AB  VAD 0 7AB Դp AB D dAB D qAB $ !AB <@ &AB Tp eAB Dp 7AB  FB 0  AG @ ,AB еp  AG  'LB  "IB  &OB 0 ,AB H@ AB FIh nAB Qp )FB   AG  NAB ж kAB Fp AB FI VAB E0 lAB FIP IAB FFp@ TAB D AB F` \AG E̷ AB E EAB  AB BC$ AB FD AD \ AB AG | AB LHS AB FP AB F0 # AB BF`  AB I  AB HH@ ^AB BF`@ AM x` AD  MAB R 9AB Fй #AB  @ AB HEI P AG $p AD < _AB I\ UAB C |P AB IFF@ AB E  AB FFI AB F AB VF$0 AB F D AB HEEh AB C` !AB F AG  AB OI AB ` AD  AB E0 AB CP# BAB BFp$ AB I+ AB F/ /AB ȼ 0 /AB P0 AB AG 2 AB BF 3 AB AG@4 KAB FF`5 AB AG5  AB F C rAB FIFĽ0D ]AB CG AB I 0V rAB FIF(V AB EHW _AB C hZ bAB FUHP] AB FzR| AB E<hAB E\(-AB E|8EAB EhAB \ZAB Ch  e oq.  v 0t4@oooNooPo o`EkEItI@rIxG rIrPg g @g @g d‡tg `g  g Xg Tg ,g (g tg @`$s  \pf $f f f k k k k 2Zk k  k  k  k   k lp { }k ϱ k k k k k  k !k #k $k %k "k &'k (i )k >k <% - { }k ;Z ( )a |Õ &k  g #Ս w N O P O " "- @#c @" 0M 0M 0M% 0M. 0M: 0ME 0MM  R H pMO M_@f ! @P[ @Pc @Pl 0Mw 0M   Nm @"O abefhikmnp,r$tuv xBCE4HI PT0+ F K R Y a h p x          ȟ П ؟         ! * 0 7 > J V _ j u         Π ڠ      " . : F Q \ g r }      K  Ս    '§   ] , Q n  ­  P    ` 0  0          B H ##   t[   |[ ^ [ .   [4 > 0  [G d [L T  [[ i  [l }  [  @  [  @ [  P [ e` %[p  8 [  8 [  7 [ s 8 [ï ٯ ; [ _k B  \    \ l R -\ KsPW  \ dW $\ddX ,\H ʉ d 4\ ͉ c <\+ re D\ g i L\= : o T\ U x \\ Z v d\D `| l\d a  t\e w  |\   \| _  \ .k  \ kP \@   \p    \   -\° }  -\ް m \   \ ]  \    \  P  \   \$ B  \ȶ I  \O f  ]k k  ] < ] k ]H p$]t 2,]x 4] k <] k D]0 lL]T  T]  \]  d] ȱ l]ұ Ct]   |]  Њ ] ByЄ ] 4 @ ] :  ] o ] A  ] HkakBT?@Ī[\<\|]Ы^^D_p`{Ь{|T}}ԭ~ 7;?CGKʍ OUXb q ؈  k  e h u x   žƞ. ʞΞў՞؞| p  ܞ!"#$%!&+'6(G)Y*b+l,r-y---..1/?/0o 12345g 6789ʟ:Ɵ;П<ߟ=>? @[-\7\G]\^g^y_`{{|}ɠ}Y~ `uV tVtVbash.debugELFP4o 4 (444444" " " ввK" HHHDDPtd- T5T5Qtd 44HH !hh$4o3>   5yF.vNoNN%6[o4j 445@s tt50 |;0wԻ;p PPHLe e    5yoP   F.vNoNN56[oDj 44E@s ttE0|K0wԻKp PPXLe e